G protein alpha Antibody (H00002778-D01P)

G protein alpha Antibody

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax
Loading...
Loading...Unit Size: 0.1 mg
 
Bulk Request
G protein alpha Antibody Summary:
Species:Hu
Applications:ELISA, WB
Clonality:Polyclonal
Gene:GNAS
Purity:Protein A purified
Host:Rabbit
Specificity:GNAS - GNAS complex locus,
 
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional G protein alpha Products
G protein alpha Antibody Details:
Immunogen:GNAS (NP_000507.1, 1 a.a. ~ 394 a.a) full-length human protein.
Epitope:MGCLGNSKTEDQRNEEKAQREANKKIEKQL QKDKQVYRATHRLLLLGAGESGKSTIVKQM RILHVNGFNGEGGEEDPQAARSNSDGEKAT KVQDIKNNLKEAIETIVAAMSNLVPPVELA NPENQFRVDYILSVMNVPDFDFPPEFYEHA KALWEDEGVRACYERSNEYQLIDCAQYFLD KIDVIKQADYVPSDQDLLRCRVLTSGIFET KFQVDKVNFHMFDVGGQRDERRKWIQCFND VTAIIFVVASSSYNM
Species Reactivity:

Human.

Applications:
Uses:Antibody reactive against recombinant protein with GST tag on ELISA and western blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.
Dilutions:Western Blot 1:500, ELISA
Unit Size:0.1 mg
Concentration:Please see the vial label for concentration.
Notes:
This product is produced by and distributed for Abnova, a company based in Taiwan.
Packaging:
Storage:Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:In 1x PBS, pH 7.2
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: GNAS
Entrez2778 (Human)
Swiss ProtNP_000507.1 (Human)
 
Background:

This locus has a highly complex imprinted expression pattern. It gives rise to maternally, paternally, and biallelically expressed transcripts that are derived from four alternative promoters and 5' exons. Some transcripts contains a differentially methylated region (DMR) at their 5' exons, and this DMR is commonly found in imprinted genes and correlates with transcript expression. An antisense transcript is produced from an overlapping locus on the opposite strand. One of the transcripts produced from this locus, and the antisense transcript, are paternally expressed noncoding RNAs, and may regulate imprinting in this region. In addition, one of the transcripts contains a second overlapping ORF, which encodes a structurally unrelated protein - Alex. Alternative splicing of downstream exons is also observed, which results in different forms of the stimulatory G-protein alpha subunit, a key element of the classical signal transduction pathway linking receptor-ligand interactions with the activation of adenylyl cyclase and a variety of cellular reponses. Multiple transcript variants encoding different isoforms have been found for this gene. Mutations in this gene result in pseudohypoparathyroidism type 1a, pseudohypoparathyroidism type 1b, Albright hereditary osteodystrophy, pseudopseudohypoparathyroidism, McCune-Albright syndrome, progressive osseus heteroplasia, polyostotic fibrous dysplasia of bone, and some pituitary tumors. [provided by RefSeq]

Jump to: Images, Ask a Question

Working with G protein alpha

G protein alpha Antibody Images (1)
Western Blot analysis of GNAS expression in transfected 293T cell line by GNAS MaxPab rabbit polyclonal antibody.

Lane 1: GNAS transfected lysate(45.70 KDa).
Lane 2: Non-transfected lysate.
Reviews (0)  Have you used this product? Review this product to earn Novus Rewards.

Ask a Scientist

Can't find an answer to your question about G protein alpha? Ask us by using live chat or by submitting your questions below:

 
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies

Related Products

Lysates (2)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
G protein alpha LysateNBL1-11160WB(1)

G protein alpha LysateH00002778-T02WB

Peptides and Proteins
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
G protein alpha Recombinant ProteinH00002778-P01HuELISA, WB(1)

Primary Antibodies (10)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
G protein alpha AntibodyNBP1-89752HuIHC-P, WB(2)

G protein alpha AntibodyNBP1-89753HuIHC-P, WB(2)

G protein alpha AntibodyNBP1-49874Bv, Hu, Mu, RtPEP-ELISA, WB

G protein alpha AntibodyNBP1-31405HuIHC-P, WB(2)

G protein alpha AntibodyNBP1-58349Ca, Hu, Mu, RtWB(1)

... and 5 more. See All »
RNAi (4)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
G protein alpha RNAiH00002778-R01Hu(1)(4)

G protein alpha RNAiH00002778-R03Hu(1)(4)

G protein alpha RNAiH00002778-R04Hu(1)(4)

G protein alpha RNAiH00002778-R02Hu(1)(4)

Secondary Antibodies
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Rabbit IgG Antibody [HRP]NB730-HRbELISA, ICC, IHC-P, WB(5)

Rabbit IgG Antibody [FITC]NB730-FRbICC, IHC-P(1)

Rabbit IgG Antibody [Biotin]NB730-BRbELISA, ICC, IHC-P, WB

Rabbit IgG, H/L Chains Antibody [DyLight 488]NBP1-72944RbFLISA, IF, WB(3)

Rabbit IgG Antibody [Alkaline Phosphatase]NB730-APRbELISA, ICC, IHC-P, WB(1)

See All »

Jump to: Novus Explorer, Research Areas

G protein alpha in Context


Research Areas related to G protein alpha (1):
Novus Explorer for G protein alpha gene

Try our bioinformatic tool that shows the relationships between GNAS and other genes, diseases, pathways and post-translational modifications.