Fibrillarin Antibody 0.1 mg Nucleolar Marker

Fibrillarin NBP1-57272

Contact Information

Choose a country to view pricing and purchasing information.

More on NBP1-57272

  • All Fibrillarin Products
  • Alternate Names
     
  • Submit a Review

Ordering Information: NBP1-57272

Catalog NumberNBP1-57272
  • FormUnconjugated
  • Size(s)0.1 mg
  • Price, Shipping
    & Availability
     

     
  •  

Fibrillarin Antibody Summary

 
Species Human, Mouse, Bovine, Canine, Guinea Pig, Rabbit
Tested Applications WB, IHC, IHC-P
Clonality Polyclonal
Host Rabbit
Gene FBL
Purity IgG purified
Guarantee Plus All of our products are backed by our 100% guarantee to work for stated and predicted species and applications.
Innovator's Reward Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Fibrillarin Antibody Details

 
Marker Nucleolar Marker
Immunogen Synthetic peptides corresponding to FBL (fibrillarin) The peptide sequence was selected from the N terminal of FBL . Peptide sequence GGGFHSGGNRGRGRGGKRGNQSGKNVMVEPHRHEGVFICRGKED ALVTKN.

Species Reactivity

 
Expected identity based on immunogen sequence: Canine: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 92%; Bovine: 85%

Applications/Dilutions

 
Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes

This is a rabbit polyclonal antibody against FBL and was validated on Western Blot and immunohistochemistry-p

Product PDFs

Reviews

Earn rewards points by submitting your review for Fibrillarin Antibody (NBP1-57272).
Submit a Review

Publications

Earn rewards if you have published using Fibrillarin Antibody (NBP1-57272).
Submit a Publication

Controls & Support Products

Research Tools

View all Fibrillarin Research Tools.

Notes

 
The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Packaging, Storage & Formulations

 
Storage Store at -20C. Avoid freeze-thaw cycles.
Buffer PBS & 2% Sucrose lyophilized with the antibody.
Unit Size 0.1 mg
Concentration LYOPH mg/ml
Reconstitution Instructions Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100ul of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1 mg/ml in PBS buffer.
Preservative No Preservative
Limitations This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

 
Gene Symbol FBL
Uniprot

Alternate Names for Fibrillarin

 
  • EC 2.1.1.37
  • EC 2.1.1,34-kD nucleolar scleroderma antigen
  • FIB1,34 kDa nucleolar scleroderma antigen
  • RNU3IP1
  • EC 2.1.1.-
  • FIB
  • FLRNrRNA 2'-O-methyltransferase fibrillarin
  • RNA, U3 small nucleolar interacting protein 1
  • fibrillarin

Related Products by Gene

Background

 
FBL is a component of a nucleolar small nuclear ribonucleoprotein (snRNP) particle thought to participate in the first step in processing preribosomal RNA. It is associated with the U3, U8, and U13 small nuclear RNAs and is located in the dense fibrillar component (DFC) of the nucleolus. FBL contains an N-terminal repetitive domain that is rich in glycine and arginine residues, like fibrillarins in other species. Its central region resembles an RNA-binding domain and contains an RNP consensus sequence. Antisera from approximately 8% of humans with the autoimmune disease scleroderma recognize fibrillarin.This gene product is a component of a nucleolar small nuclear ribonucleoprotein (snRNP) particle thought to participate in the first step in processing preribosomal RNA. It is associated with the U3, U8, and U13 small nuclear RNAs and is located in the dense fibrillar component (DFC) of the nucleolus. The encoded protein contains an N-terminal repetitive domain that is rich in glycine and arginine residues, like fibrillarins in other species. Its central region resembles an RNA-binding domain and contains an RNP consensus sequence. Antisera from approximately 8% of humans with the autoimmune disease scleroderma recognize fibrillarin.