Fibrillarin Antibody 0.1 mg Nucleolar Marker

Click image to view larger
Western Blot: Fibrillarin Antibody [NBP1-57272] - Jurkat cell lysate, Antibody Titration: 1.25ug/ml
Immunohistochemistry-Paraffin: Fibrillarin Antibody [NBP1-57272] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.
Download Datasheet
See All Related

Ordering Information: NBP1-57272

  • Catalog Number
    NBP1-57272
  • Displayed Format
    Unconjugated
  • Size(s)
    0.1 mg
  • Availability
  • Price
    Shipping
  

Fibrillarin Antibody Summary

Species Human, Mouse, Bovine, Canine, Guinea Pig, Rabbit
Tested Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Gene
FBL
Purity
IgG purified
Guarantee Plus
All of our products are backed by our 100% guarantee to work for stated and predicted species and applications.
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Fibrillarin Antibody Details

Marker
Nucleolar Marker
Immunogen
Synthetic peptides corresponding to FBL (fibrillarin) The peptide sequence was selected from the N terminal of FBL. Peptide sequence GGGFHSGGNRGRGRGGKRGNQSGKNVMVEPHRHEGVFICRGKEDALVTKN.

Species Reactivity

Expected identity based on immunogen sequence: Canine: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 92%; Bovine: 85%

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against FBL and was validated on Western Blot and immunohistochemistry-p

Contact Information

Product PDFs

Frequently Purchased Together

Reviews

Earn rewards points by submitting your review for Fibrillarin Antibody (NBP1-57272). Be the first to review this product and earn double rewards points!

Publications

Earn rewards if you have published using Fibrillarin Antibody (NBP1-57272).

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose lyophilized with the antibody.
Unit Size
0.1 mg
Concentration
LYOPH
Reconstitution Instructions
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100ul of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1 mg/ml in PBS buffer.
Preservative
No Preservative
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

Gene Symbol FBL
Uniprot

Alternate Names for Fibrillarin Antibody

  • EC 2.1.1,34-kD nucleolar scleroderma antigen
  • EC 2.1.1.-
  • EC 2.1.1.37
  • FIB
  • FIB1,34 kDa nucleolar scleroderma antigen
  • fibrillarin
  • FLRNrRNA 2'-O-methyltransferase fibrillarin
  • RNA, U3 small nucleolar interacting protein 1
  • RNU3IP1
Show More

Related Products by Gene

Background

FBL is a component of a nucleolar small nuclear ribonucleoprotein (snRNP) particle thought to participate in the first step in processing preribosomal RNA. It is associated with the U3, U8, and U13 small nuclear RNAs and is located in the dense fibrillar component (DFC) of the nucleolus. FBL contains an N-terminal repetitive domain that is rich in glycine and arginine residues, like fibrillarins in other species. Its central region resembles an RNA-binding domain and contains an RNP consensus sequence. Antisera from approximately 8% of humans with the autoimmune disease scleroderma recognize fibrillarin.This gene product is a component of a nucleolar small nuclear ribonucleoprotein (snRNP) particle thought to participate in the first step in processing preribosomal RNA. It is associated with the U3, U8, and U13 small nuclear RNAs and is located in the dense fibrillar component (DFC) of the nucleolus. The encoded protein contains an N-terminal repetitive domain that is rich in glycine and arginine residues, like fibrillarins in other species. Its central region resembles an RNA-binding domain and contains an RNP consensus sequence. Antisera from approximately 8% of humans with the autoimmune disease scleroderma recognize fibrillarin.

Reviews for Fibrillarin Antibody (NBP1-57272) (0)

There are no reviews for Fibrillarin Antibody (NBP1-57272).
By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image
Have you used Fibrillarin Antibody (NBP1-57272)? Submit your review and earn rewards points which can be used for merchandise & discounts.
Points can be redeemed for discounts and gift cards:
$50/€35/£30/$50CAN Amazon Gift Card1000 Points
Items ships for Free, please disregard any shipping charges.
$50/€35/£30/$50CAN Off Purchase (credited after checkout)1000 Points
Discount is removed from total when the order is processed. The discount will not appear in your shopping cart on check out.

Publications for Fibrillarin Antibody (NBP1-57272) (0)

There are no publications for Fibrillarin Antibody (NBP1-57272).
By submitting a publication earn 200 points for your submission points towards our Rewards Program.
Have you published using Fibrillarin Antibody (NBP1-57272)? Earn rewards points which can be used for merchandise & discounts.
Points can be redeemed for discounts and gift cards:
$50/€35/£30/$50CAN Amazon Gift Card1000 Points
Items ships for Free, please disregard any shipping charges.
$50/€35/£30/$50CAN Off Purchase (credited after checkout)1000 Points
Discount is removed from total when the order is processed. The discount will not appear in your shopping cart on check out.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

Ask a Scientist

Submit your question on below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
CAPTCHA
This question is for testing whether or not you are a human visitor and to prevent automated spam submissions.

FAQs for Fibrillarin (2)

  1. In the immunohistochemistry paraffin section protocol....the PBS buffer....should it be at certain pH?
    • For IHC application, different labs cites the pH of PBS buffer in the range of 7.1 - 7.6 but most commonly used pH is pH 7.4 (this is what we use in our lab). You may use this PBS (pH 7.4) for making permeablization buffer, antibody diluent buffers and for making wash buffer. For more on the protocol that we use in our lab and for IHC-P troubleshooting suggestions, you may visit: IHC-P Protocol and IHC-P Troubleshooting.
  2. I was wondering what does Format 7C mean as far as anitbodies go?
    • 7C is a fluorophore - it is useful for FLOW. The details of the fluor are (A=425, E=500)