Fibrillarin Antibody 0.1 mg Nucleolar Marker

Click image to view larger
Western Blot: Fibrillarin Antibody [NBP1-57272] - Jurkat cell lysate, Antibody Titration: 1.25ug/ml
Immunohistochemistry-Paraffin: Fibrillarin Antibody [NBP1-57272] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.
Download Datasheet
See All Related

Ordering Information: NBP1-57272

  • Catalog Number
  • Displayed Format
  • Size(s)
    0.1 mg
  • Availability
  • Price

Fibrillarin Antibody Summary

Species Human
Tested Applications WB, IHC, IHC-P
Protein A purified
Guarantee Plus
All of our products are backed by our 100% guarantee to work for stated and predicted species and applications.
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Fibrillarin Antibody Details

Nucleolar Marker
Synthetic peptides corresponding to FBL (fibrillarin) The peptide sequence was selected from the N terminal of FBL. Peptide sequence GGGFHSGGNRGRGRGGKRGNQSGKNVMVEPHRHEGVFICRGKEDALVTKN.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against FBL and was validated on Western Blot and immunohistochemistry-p

The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Molecular Weight
35 kDa

Contact Information

Product PDFs

Frequently Purchased Together


Earn rewards points by submitting your review for Fibrillarin Antibody (NBP1-57272). Be the first to review this product and earn double rewards points!


Earn rewards if you have published using Fibrillarin Antibody (NBP1-57272).


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
Unit Size
0.1 mg
Reconstitution Instructions
Centrifuge at 12,000 x g for 20 seconds. Reconstitute with 0.1 ml distilled water to a final concentration of 1.0 mg/ml in PBS buffer. Vortex followed by centrifuge again to pellet the solution.
No Preservative
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.


Gene Symbol FBL

Alternate Names for Fibrillarin Antibody

  • EC 2.1.1,34-kD nucleolar scleroderma antigen
  • EC 2.1.1.-
  • EC
  • FIB
  • FIB1,34 kDa nucleolar scleroderma antigen
  • fibrillarin
  • FLRNrRNA 2'-O-methyltransferase fibrillarin
  • RNA, U3 small nucleolar interacting protein 1
  • RNU3IP1
Show More

Related Products by Gene


FBL is a component of a nucleolar small nuclear ribonucleoprotein (snRNP) particle thought to participate in the first step in processing preribosomal RNA. It is associated with the U3, U8, and U13 small nuclear RNAs and is located in the dense fibrillar component (DFC) of the nucleolus. FBL contains an N-terminal repetitive domain that is rich in glycine and arginine residues, like fibrillarins in other species. Its central region resembles an RNA-binding domain and contains an RNP consensus sequence. Antisera from approximately 8% of humans with the autoimmune disease scleroderma recognize fibrillarin.This gene product is a component of a nucleolar small nuclear ribonucleoprotein (snRNP) particle thought to participate in the first step in processing preribosomal RNA. It is associated with the U3, U8, and U13 small nuclear RNAs and is located in the dense fibrillar component (DFC) of the nucleolus. The encoded protein contains an N-terminal repetitive domain that is rich in glycine and arginine residues, like fibrillarins in other species. Its central region resembles an RNA-binding domain and contains an RNP consensus sequence. Antisera from approximately 8% of humans with the autoimmune disease scleroderma recognize fibrillarin.

Reviews for Fibrillarin Antibody (NBP1-57272) (0)

There are no reviews for Fibrillarin Antibody (NBP1-57272).
By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image
Have you used Fibrillarin Antibody (NBP1-57272)? Submit your review and earn rewards points which can be used for merchandise & discounts.
Points can be redeemed for discounts and gift cards:
$50/€35/£30/$50CAN Amazon Gift Card1000 Points
Items ships for Free, please disregard any shipping charges.
$50/€35/£30/$50CAN Off Purchase (credited after checkout)1000 Points
Discount is removed from total when the order is processed. The discount will not appear in your shopping cart on check out.

Publications for Fibrillarin Antibody (NBP1-57272) (0)

There are no publications for Fibrillarin Antibody (NBP1-57272).
By submitting a publication earn 200 points for your submission points towards our Rewards Program.
Have you published using Fibrillarin Antibody (NBP1-57272)? Earn rewards points which can be used for merchandise & discounts.
Points can be redeemed for discounts and gift cards:
$50/€35/£30/$50CAN Amazon Gift Card1000 Points
Items ships for Free, please disregard any shipping charges.
$50/€35/£30/$50CAN Off Purchase (credited after checkout)1000 Points
Discount is removed from total when the order is processed. The discount will not appear in your shopping cart on check out.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

Ask a Scientist

Submit your question on below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
This question is for testing whether or not you are a human visitor and to prevent automated spam submissions.

FAQs for Fibrillarin (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Viewed This Item Also Viewed...

Simple Western lane view shows lysates of human liver tissue, loaded at 0.2 mg/mL. A specific band was detected for Coagulation Factor II/Thrombin at approximately 95 kDa (as indicated) using 10 µg/mL of Goat Anti-Human Coagulation Factor II/Thrombin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1148) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system. Human peripheral blood monocytes were stained with Goat Anti-Human Coagulation Factor II/Thrombin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1148, filled histogram) or isotype control antibody (Catalog # AB-108-C, open histogram), followed by Phycoerythrin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0107).

Goat Polyclonal
Species Human
Applications WB, Simple Western, Flow

1 Publication
Western Blot: Nucleophosmin Antibody [NB110-61646] - Detection of mutant Nucleophosmin in OCI-AML3 lysates.Immunocytochemistry/Immunofluorescence: Nucleophosmin Antibody [NB110-61646] - Nucleophosmin localization by immunofluorescence in HL-60 cells (negative control).Immunocytochemistry/Immunofluorescence: Nucleophosmin Antibody [NB110-61646] - Nucleophosmin antibody was tested in HeLa cells with FITC (green). Nuclei and alpha-tubulin were counterstained with Dapi (blue) and Dylight 550 (red).

Rabbit Polyclonal
Species Human
Applications WB, Flow, ICC/IF...MORE

Western Blot: Nucleolin Antibody [NB600-241] - Detection of nucleolin in crude PD31 nuclear extracts.Immunocytochemistry/Immunofluorescence: Nucleolin Antibody [NB600-241] - IF analysis of Nucleolin MCF-7 breast cancer cells. Image courtsey of product review by Lacey Litchfield.Immunohistochemistry: Nucleolin Antibody [NB600-241] - Detection of Nucleolin in human tonsil germinal center.

Rabbit Polyclonal
Species Human, Mouse, Rat...MORE
Applications WB, Simple Western, ChIP...MORE

     1 Review

13 Publications
Western Blot: Coilin Antibody [NBP2-15939] - Sample (30 ug of whole cell lysate) A: 293T B: A431 C: HeLa D: HepG2 7. 5% SDS PAGE gel, diluted at 1:1000.Immunocytochemistry/Immunofluorescence: Coilin Antibody [NBP2-15939] - Confocal immunofluorescence analysis of methanol-fixed HeLa, using Coilin antibody (Green) at 1:500 dilution. Alpha-tubulin filaments are labeled with Alpha-tubulin antibody (Red) at 1:500.Immunohistochemistry-Paraffin: Coilin Antibody [NBP2-15939] - Immunohistochemical analysis of paraffin-embedded HBL435 xenograft, using antibody at 1:500 dilution.

Rabbit Polyclonal
Species Human
Applications WB, ICC/IF, IHC...MORE

Western Blot: RNPC3 Antibody [NBP1-57138] - Human Spleen lysate, concentration 0.2-1 ug/ml.

Rabbit Polyclonal
Species Human
Applications WB

Western blot shows lysate of human liver tissue. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human Serum Albumin Monoclonal Antibody (Catalog # MAB1455) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for Albumin at approximately 65-70 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.HepG2 human hepatocellular carcinoma cell line was stained with Mouse Anti-Human/Mouse Serum Albumin Monoclonal Antibody (Catalog # MAB1455, filled histogram) or isotype control antibody (Catalog # MAB003, open histogram), followed by Allophycocyanin-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # F0101B). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.    Simple  Western lane view shows lysates of human liver tissue, loaded at  0.2 mg/mL. A specific band was detected for Albumin at approximately  64 kDa (as indicated) using 10 µg/mL of Mouse Anti-Human  Serum Albumin Monoclonal Antibody (Catalog # MAB1455). This experiment was  conducted under reducing conditions and using the 12-230 kDa  separation system.

Mouse Monoclonal
Species Human
Applications WB, Simple Western, ICC...MORE

     2 Reviews

9 Publications

Goat Polyclonal
Species Human
Applications WB

8 Publications
Western Blot: UBTF Antibody [NBP1-82545] - Lane 1: Marker [KDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Mouse cerebral Cortex tissue Immunocytochemistry/Immunofluorescence: UBTF Antibody [NBP1-82545] - Staining of mouse thalamus shows nuclear immunoreactivity in anterodorsal thalamic nucleus neurons. Immunohistochemistry-Paraffin: UBTF Antibody [NBP1-82545] - Staining of human hippocampus shows nuclear immunoreactivity in neurons.

Rabbit Polyclonal
Species Human, Mouse
Applications WB, ICC/IF, IHC...MORE

     1 Review

1 Publication

Species Human

35 Publications
Immunohistochemistry: SI Sucrase-Isomaltase Antibody [NBP1-87581] - Immunohistochemical staining of human small intestine shows strong luminal membranous and cytoplasmic positivity in glandular cells.

Rabbit Polyclonal
Species Human
Applications IHC, IHC-P

1 Publication
Western Blot: PMEL17/SILV Antibody [NBP1-69571] - This Anti-SILV antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1.25ug/ml.Immunohistochemistry-Paraffin: PMEL17/SILV Antibody [NBP1-69571] - Human Kidney: epithelial cells of renal tubule (indicated with arrows).

Rabbit Polyclonal
Species Human
Applications WB, IHC, IHC-P

4 Publications
Western Blot: AFM Antibody [NBP2-15304] - Sample (30 ug of whole cell lysate) A: 293T B: A431 C: HeLa D: HepG2 7. 5% SDS PAGE; antibody diluted at 1:5000.Immunocytochemistry/Immunofluorescence: AFM Antibody [NBP2-15304] - Analysis of methanol-fixed HeLa, using antibody at 1:500 dilution.Immunohistochemistry-Paraffin: AFM Antibody [NBP2-15304] - Paraffin-embedded Cal27 xenograft, using antibody at 1:500 dilution.

Rabbit Polyclonal
Species Human, Mouse
Applications WB, ICC/IF, IHC...MORE


Species Human
Applications BA

8 Publications

Species Human

200 Publications
Western Blot: NOLC1 Antibody [NBP1-58200] - NOLC1 antibody - C-terminal region validated by WB using HepG2 cell lysate at 2.5ug/ml.Immunocytochemistry/Immunofluorescence: NOLC1 Antibody [NBP1-58200] - Zebrafish kidney, 1:250  Image Submitted By:  James Lister  Virginia Commonwealth UniversityImmunohistochemistry-Paraffin: NOLC1 Antibody [NBP1-58200] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Rabbit Polyclonal
Species Human, Zebrafish
Applications WB, ICC/IF, IHC...MORE

Western Blot: NOP58 Antibody [NBP1-81681] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)Immunocytochemistry/Immunofluorescence: NOP58 Antibody [NBP1-81681] - Staining of human cell line A-431 shows positivity in nucleus & nucleoli.Immunohistochemistry-Paraffin: NOP58 Antibody [NBP1-81681] - Staining of human esophagus shows strong nuclear positivity, seen as distinctly stained nucleoli, in squamous epithelial cells.

Rabbit Polyclonal
Species Human, Mouse, Rat
Applications WB, ICC/IF, IHC...MORE

Western Blot: SMN Antibody (2B1) [NB100-1936] - Western blot analysis of SMN expression in 1) HeLa, 2) NTera2, 3) HepG2, 4) MCF7, 5) NIH 3T3, 6) PC12 and 7) COS7 whole cell lysates.Immunocytochemistry/Immunofluorescence: SMN Antibody (2B1) [NB100-1936] - The SMN antibody was tested at a 1:250 dilution in HeLa cells against Dylight 488 (Green). Actin nuclei were counterstained against Phalloidin 568 (Red) and DAPI (Blue), respectively.Immunohistochemistry: SMN Antibody (2B1) [NB100-1936] - Immunohistochemical analysis of SMN on mouse brain using NB100-1936.

Mouse Monoclonal
Species Human, Mouse, Rat...MORE
Applications WB, ELISA, ICC/IF...MORE

16 Publications
Western Blot: SMN2 Antibody (2B11-2A9) [H00006607-M01] - SMN2 monoclonal antibody (M01), clone 2B11-2A9 Analysis of SMN2 expression in IMR-32.Immunocytochemistry/Immunofluorescence: SMN2 Antibody (2B11-2A9) [H00006607-M01] - Analysis of monoclonal antibody to SMN2 on HeLa cell. Antibody concentration 10 ug/ml.Immunohistochemistry-Paraffin: SMN2 Antibody (2B11-2A9) [H00006607-M01] - Analysis of monoclonal antibody to SMN2 on formalin-fixed paraffin-embedded human heart tissue. Antibody concentration 1 ~ 10 ug/ml.

Mouse Monoclonal
Species Human
Applications WB, ELISA, ICC/IF...MORE

Western Blot: SC35 Antibody (SC-35) [NB100-1774] - SC-35 recombinant protein (3 ug) was separated on SDS-PAGE and probed with Mouse Anti-Splicing Factor SC-35 Clone: SC-35. The antibody was developed using Goat Anti-Mouse IgG-Peroxidase and a chemiluminescent substrate. Lanes 1. Antibody dilution 1:100;   2. Antibody dilution 1:250; 3. Antibody dilution 1:500; 4. Antibody dilution 1:1,000Immunocytochemistry/Immunofluorescence: SC35 Antibody (SC-35) [NB100-1774] - HS-68 cells were fixed and permeabilized with 4% Paraformaldehyde and 0.5% Triton X-100. Fixed cells were stained with Mouse Anti-Splicing Factor Clone: SC-35 diluted to 1:2,000. The antibody was developed using Goat Anti-Mouse IgG, FITC-conjugate.

Mouse Monoclonal
Species Human, Rat, Amphibian...MORE
Applications WB, EM, ELISA...MORE

5 Publications