Fibrillarin Antibody 0.1 mg Nucleolar Marker

Click image to view larger
Western Blot: Fibrillarin Antibody [NBP1-57272] - Jurkat cell lysate, Antibody Titration: 1.25ug/ml
Immunohistochemistry-Paraffin: Fibrillarin Antibody [NBP1-57272] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.
Download Datasheet
See All Related

Ordering Information: NBP1-57272

  • Catalog Number
  • Displayed Format
  • Size(s)
    0.1 mg
  • Availability
  • Price

Fibrillarin Antibody Summary

Species Human, Mouse, Bovine, Canine, Guinea Pig, Rabbit
Tested Applications WB, IHC, IHC-P
IgG purified
Guarantee Plus
All of our products are backed by our 100% guarantee to work for stated and predicted species and applications.
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Fibrillarin Antibody Details

Nucleolar Marker
Synthetic peptides corresponding to FBL (fibrillarin) The peptide sequence was selected from the N terminal of FBL. Peptide sequence GGGFHSGGNRGRGRGGKRGNQSGKNVMVEPHRHEGVFICRGKEDALVTKN.

Species Reactivity

Expected identity based on immunogen sequence: Canine: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 92%; Bovine: 85%


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against FBL and was validated on Western Blot and immunohistochemistry-p

Contact Information

Product PDFs

Frequently Purchased Together


Earn rewards points by submitting your review for Fibrillarin Antibody (NBP1-57272). Be the first to review this product and earn double rewards points!


Earn rewards if you have published using Fibrillarin Antibody (NBP1-57272).


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose lyophilized with the antibody.
Unit Size
0.1 mg
Reconstitution Instructions
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100ul of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1 mg/ml in PBS buffer.
No Preservative
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.


Gene Symbol FBL

Alternate Names for Fibrillarin Antibody

  • EC 2.1.1,34-kD nucleolar scleroderma antigen
  • EC 2.1.1.-
  • EC
  • FIB
  • FIB1,34 kDa nucleolar scleroderma antigen
  • fibrillarin
  • FLRNrRNA 2'-O-methyltransferase fibrillarin
  • RNA, U3 small nucleolar interacting protein 1
  • RNU3IP1
Show More

Related Products by Gene


FBL is a component of a nucleolar small nuclear ribonucleoprotein (snRNP) particle thought to participate in the first step in processing preribosomal RNA. It is associated with the U3, U8, and U13 small nuclear RNAs and is located in the dense fibrillar component (DFC) of the nucleolus. FBL contains an N-terminal repetitive domain that is rich in glycine and arginine residues, like fibrillarins in other species. Its central region resembles an RNA-binding domain and contains an RNP consensus sequence. Antisera from approximately 8% of humans with the autoimmune disease scleroderma recognize fibrillarin.This gene product is a component of a nucleolar small nuclear ribonucleoprotein (snRNP) particle thought to participate in the first step in processing preribosomal RNA. It is associated with the U3, U8, and U13 small nuclear RNAs and is located in the dense fibrillar component (DFC) of the nucleolus. The encoded protein contains an N-terminal repetitive domain that is rich in glycine and arginine residues, like fibrillarins in other species. Its central region resembles an RNA-binding domain and contains an RNP consensus sequence. Antisera from approximately 8% of humans with the autoimmune disease scleroderma recognize fibrillarin.

Reviews for Fibrillarin Antibody (NBP1-57272) (0)

There are no reviews for Fibrillarin Antibody (NBP1-57272).
By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image
Have you used Fibrillarin Antibody (NBP1-57272)? Submit your review and earn rewards points which can be used for merchandise & discounts.
Points can be redeemed for discounts and gift cards:
$50/€35/£30/$50CAN Amazon Gift Card1000 Points
Items ships for Free, please disregard any shipping charges.
$50/€35/£30/$50CAN Off Purchase (credited after checkout)1000 Points
Discount is removed from total when the order is processed. The discount will not appear in your shopping cart on check out.

Publications for Fibrillarin Antibody (NBP1-57272) (0)

There are no publications for Fibrillarin Antibody (NBP1-57272).
By submitting a publication earn 200 points for your submission points towards our Rewards Program.
Have you published using Fibrillarin Antibody (NBP1-57272)? Earn rewards points which can be used for merchandise & discounts.
Points can be redeemed for discounts and gift cards:
$50/€35/£30/$50CAN Amazon Gift Card1000 Points
Items ships for Free, please disregard any shipping charges.
$50/€35/£30/$50CAN Off Purchase (credited after checkout)1000 Points
Discount is removed from total when the order is processed. The discount will not appear in your shopping cart on check out.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

Ask a Scientist

Submit your question on below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
This question is for testing whether or not you are a human visitor and to prevent automated spam submissions.

FAQs for Fibrillarin (2)

  1. In the immunohistochemistry paraffin section protocol....the PBS buffer....should it be at certain pH?
    • For IHC application, different labs cites the pH of PBS buffer in the range of 7.1 - 7.6 but most commonly used pH is pH 7.4 (this is what we use in our lab). You may use this PBS (pH 7.4) for making permeablization buffer, antibody diluent buffers and for making wash buffer. For more on the protocol that we use in our lab and for IHC-P troubleshooting suggestions, you may visit: IHC-P Protocol and IHC-P Troubleshooting.
  2. I was wondering what does Format 7C mean as far as anitbodies go?
    • 7C is a fluorophore - it is useful for FLOW. The details of the fluor are (A=425, E=500)

Customers Who Viewed This Item Also Viewed...

Western Blot: Thrombin Antibody [NBP1-58268] - 721_B tissue lysate at a concentration of 1ug/ml.Immunohistochemistry-Paraffin: Thrombin Antibody [NBP1-58268] - Human Placenta Tissue, 5.0ug/ml.Immunohistochemistry-Paraffin: Thrombin Antibody [NBP1-58268] - Human Placenta Tissue

Rabbit Polyclonal
Species Zebrafish, Sheep, Porcine...MORE
Applications IHC-P, IHC, WB

Western Blot: Nucleophosmin Antibody [NB110-61646] - Detection of mutant Nucleophosmin in OCI-AML3 lysates.Immunocytochemistry/Immunofluorescence: Nucleophosmin Antibody [NB110-61646] - Nucleophosmin localization by immunofluorescence in HL-60 cells (negative control).Immunocytochemistry/Immunofluorescence: Nucleophosmin Antibody [NB110-61646] - Nucleophosmin antibody was tested in HeLa cells with FITC (green). Nuclei and alpha-tubulin were counterstained with Dapi (blue) and Dylight 550 (red).

Rabbit Polyclonal
Species Human
Applications IP, IHC-P, IHC...MORE

Western Blot: Nucleolin Antibody [NB600-241] - Detection of nucleolin in crude PD31 nuclear extracts.Immunocytochemistry/Immunofluorescence: Nucleolin Antibody [NB600-241] - IF analysis of Nucleolin MCF-7 breast cancer cells. Image courtsey of product review by Lacey Litchfield.Immunohistochemistry: Nucleolin Antibody [NB600-241] - Detection of Nucleolin in human tonsil germinal center.

Rabbit Polyclonal
Species Human, Mouse, Rat...MORE
Applications WB, ChIP, EM...MORE

     1 Review

9 Publications
Western Blot: Coilin Antibody [NBP2-15939] - Sample (30 ug of whole cell lysate) A: 293T B: A431 C: HeLa D: HepG2 7. 5% SDS PAGE gel, diluted at 1:1000.Immunocytochemistry/Immunofluorescence: Coilin Antibody [NBP2-15939] - Confocal immunofluorescence analysis of methanol-fixed HeLa, using Coilin antibody (Green) at 1:500 dilution. Alpha-tubulin filaments are labeled with Alpha-tubulin antibody (Red) at 1:500.Immunohistochemistry-Paraffin: Coilin Antibody [NBP2-15939] - Immunohistochemical analysis of paraffin-embedded HBL435 xenograft, using antibody at 1:500 dilution.

Rabbit Polyclonal
Species Human
Applications WB, ICC/IF, IHC...MORE

Western Blot: RNPC3 Antibody [NBP1-57138] - Human Spleen lysate, concentration 0.2-1 ug/ml.

Rabbit Polyclonal
Species Human, Mouse, Rat...MORE
Applications WB


Goat Polyclonal
Species Mouse
Applications IHC-P, IHC, ICC/IF...MORE

21 Publications
Western Blot: Plasminogen Antibody [NB600-930] - Goat anti Plasminogen antibody was used to detect Plasminogen under reducing ® and non-reducing (NR) conditions. Reduced samples of purified target proteins contained 4% BME and were boiled for 5 minutes. Samples of ~1ug of protein per lane were run by SDS-PAGE. Protein was transferred to nitrocellulose and probed with 1:3000 dilution of primary antibody (4C). Detection shown was using Dylight 649 conjugated Donkey anti goat 1:10K in TBS 1 hr RT.

Goat Polyclonal
Species Bacteria, Human
Applications ELISA, WB

     2 Reviews

5 Publications
Western Blot: UBTF Antibody (2D8) [H00007343-M04] - UBTF monoclonal antibody (M04), clone 2D8. Western Blot analysis of UBTF expression in NIH/3T3(Cat # L018V1 ).Immunocytochemistry/Immunofluorescence: UBTF Antibody (2D8) [H00007343-M04] - Immunofluorescence of monoclonal antibody to UBTF (H00007343-M04) on HepG2 cell . [antibody concentration 10 ug/ml]Immunohistochemistry-Paraffin: UBTF Antibody (2D8) [H00007343-M04] - Immunoperoxidase of monoclonal antibody to UBTF ( Cat# H00007343-M04 ) on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]

Mouse Monoclonal
Species Human, Mouse, Rat
Applications WB, ELISA, ICC/IF...MORE

Western Blot: C-Reactive Protein Antibody (1G1) [NBP2-22192] - Western blot analysis using C-Reactive Protein mAb against human C-Reactive Protein recombinant protein. ( AA: 1-224, Expected MW is 51 kDa)Immunohistochemistry-Paraffin: C-Reactive Protein Antibody (1G1) [NBP2-22192] - Immunohistochemical analysis of paraffin-embedded liver cancer tissues using C-Reactive Protein mouse mAb with DAB staining.Flow Cytometry: C-Reactive Protein Antibody (1G1) [NBP2-22192] - C-Reactive Protein mouse mAb (green) and negative control (red).

Mouse Monoclonal
Species Human
Applications IHC-P, IHC, FLOW...MORE

Immunohistochemistry-Paraffin: SI Sucrase-Isomaltase Antibody [NBP1-87581] Staining of human small intestine shows strong luminal membranous and cytoplasmic positivity in glandular cells.

Rabbit Polyclonal
Species Human
Applications IHC-P, IHC

Western Blot: Melanoma gp100 Antibody [NBP1-69571] - This Anti-SILV antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1.25ug/ml.Immunohistochemistry-Paraffin: PMEL Antibody [NBP1-69571] - Human Kidney: epithelial cells of renal tubule (indicated with arrows).

Rabbit Polyclonal
Species Rabbit, Porcine, Guinea Pig...MORE
Applications IHC-P, IHC, WB

2 Publications
Western Blot: AFM Antibody [NBP2-15304] - Sample (30 ug of whole cell lysate) A: 293T B: A431 C: HeLa D: HepG2 7. 5% SDS PAGE; antibody diluted at 1:5000.Immunocytochemistry/Immunofluorescence: AFM Antibody [NBP2-15304] - Analysis of methanol-fixed HeLa, using antibody at 1:500 dilution.Immunohistochemistry-Paraffin: AFM Antibody [NBP2-15304] - Paraffin-embedded Cal27 xenograft, using antibody at 1:500 dilution.

Rabbit Polyclonal
Species Human, Mouse
Applications WB, ICC/IF, IHC...MORE

Western Blot: Fibronectin Antibody [NBP1-91258] - WB analysis of Fibronectin in NIH 3T3 cell lysate.Immunocytochemistry/Immunofluorescence: Fibronectin Antibody [NBP1-91258] - Fibronectin antibody was tested in HeLa cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).Immunohistochemistry: Fibronectin Antibody [NBP1-91258] - IHC analysis of Fibronectin in human renal cancer using DAB with hematoxylin counterstain.

Rabbit Polyclonal
Species Human, Mouse
Applications IHC-P, IHC, ICC/IF...MORE

3 Publications
Western Blot: IL6 Antibody [NB600-1131] - Shows detection of a band ~21 kDa in size corresponding to anti-IL6 antibody. Molecular weight markers are also shown (MW). After transfer, the membrane was blocked for 30 minutes with 1% BSA-TBST. Detection occurred using peroxidase conjugated anti-Rabbit IgG secondary antibody diluted 1:40,000 in blocking buffer for 30 min at RT followed by reaction with FemtoMax ™ chemiluminescent substrate.Immunocytochemistry/Immunofluorescence: IL6 Antibody [NB600-1131] - IL-6 antibody was tested in Raw264.7 cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).Immunohistochemistry-Paraffin: IL6 Antibody [NB600-1131] - IHC staining of IL6 in human bladder cancer using DAB with hematoxylin counterstain.

Rabbit Polyclonal
Species Human, Mouse, Rat
Applications IP, IHC-P, IHC...MORE

6 Publications
Western Blot: NOLC1 Antibody [NBP1-58200] - NOLC1 antibody - C-terminal region validated by WB using HepG2 cell lysate at 2.5ug/ml.Immunocytochemistry/Immunofluorescence: NOLC1 Antibody [NBP1-58200] - Zebrafish kidney, 1:250  Image Submitted By:  James Lister  Virginia Commonwealth UniversityImmunohistochemistry-Paraffin: NOLC1 Antibody [NBP1-58200] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Rabbit Polyclonal
Species Human, Mouse, Rat...MORE
Applications WB, ICC/IF, IHC...MORE

Western Blot: NOP58 Antibody [NBP1-81680] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG spImmunocytochemistry/Immunofluorescence: NOP58 Antibody [NBP1-81680] - Staining of human cell line U-2 OS shows positivity in nucleoli.Immunohistochemistry-Paraffin: NOP58 Antibody [NBP1-81680] - Staining of human stomach shows nuclear and cytoplasmic positivity in glandular cells.

Rabbit Polyclonal
Species Human
Applications WB, ICC/IF, IHC...MORE

Western Blot: SMN Antibody (2B1) [NB100-1936] - Western blot analysis of SMN expression in 1) HeLa, 2) NTera2, 3) HepG2, 4) MCF7, 5) NIH 3T3, 6) PC12 and 7) COS7 whole cell lysates.Immunocytochemistry/Immunofluorescence: SMN Antibody (2B1) [NB100-1936] - The SMN antibody was tested at a 1:250 dilution in HeLa cells against Dylight 488 (Green). Actin nuclei were counterstained against Phalloidin 568 (Red) and DAPI (Blue), respectively.Immunohistochemistry: SMN Antibody (2B1) [NB100-1936] - Immunohistochemical analysis of SMN on mouse brain using NB100-1936.

Mouse Monoclonal
Species Human, Mouse, Rat...MORE
Applications WB, ELISA, ICC/IF...MORE

16 Publications

Mouse Monoclonal
Species Human
Applications S-ELISA, IHC-P, IHC...MORE

Western Blot: SC35 Antibody (SC-35) [NB100-1774] - SC-35 recombinant protein (3 ug) was separated on SDS-PAGE and probed with Mouse Anti-Splicing Factor SC-35 Clone: SC-35. The antibody was developed using Goat Anti-Mouse IgG-Peroxidase and a chemiluminescent substrate. Lanes 1. Antibody dilution 1:100; 2. Antibody dilution 1:250; 3. Antibody dilution 1:500; 4. Antibody dilution 1:1,000Immunocytochemistry/Immunofluorescence: SC35 Antibody (SC-35) [NB100-1774] - HS-68 cells were fixed and permeabilized with 4% Paraformaldehyde and 0.5% Triton X-100. Fixed cells were stained with Mouse Anti-Splicing Factor Clone: SC-35 diluted to 1:2,000. The antibody was developed using Goat Anti-Mouse IgG, FITC-conjugate.

Mouse Monoclonal
Species Human, Rat, Amphibian...MORE
Applications WB, EM, ELISA...MORE

4 Publications