Fbx32 Antibody (H00114907-B01P)

Fbx32 Antibody

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax
Loading...
Loading...Unit Size: 0.05 mg
 
Bulk Request
Fbx32 Antibody Summary:
Species:Hu
Applications:ELISA, WB
Clonality:Polyclonal
Gene:FBXO32
Purity:Protein A purified
Host:Mouse
Specificity:FBXO32 - F-box protein 32,
 
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional Fbx32 Products
Fbx32 Antibody Details:
Immunogen:FBXO32 (ENSP00000287396, 1 a.a. ~ 355 a.a) full-length human protein.
Epitope:MPFLGQDWRSPGQNWVKTADGWKRFLDEKS GSFVSDLSSYCNKEVYNKENLFNSLNYDVA AKKRKKDMLNSKTKTQYFHQEKWIYVHKGS TKERHGYCTLGEAFNRLDFSTAILDSRRFN YVVRLLELIAKSQLTSLSGIAQKNFMNILE KVVLKVLEDQQNIRLIRELLQTLYTSLCTL VQRVGKSVLVGNINMWVYRMETILHWQQQL NNIQITRPAFKGLTFTDLPLCLQLNIMQRL SDGRDLVSLGQAAPD
Species Reactivity:

Human.

Applications:
Uses:Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.
Dilutions:Western Blot 1:500, ELISA
Unit Size:0.05 mg
Concentration:Please see the vial label for concentration.
Notes:
This product is produced by and distributed for Abnova, a company based in Taiwan.
Packaging:
Storage:Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:In 1x PBS, pH 7.2
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: FBXO32
Entrez114907 (Human)
Swiss ProtENSP00000287396 (Human)
 
Background:

This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class and contains an F-box domain. This protein is highly expressed during muscle atrophy, whereas mice deficient in this gene were found to be resistant to atrophy. This protein is thus a potential drug target for the treatment of muscle atrophy. Alternative splicing of this gene results in two transcript variants encoding two isoforms of different sizes. [provided by RefSeq]

Jump to: Images, Ask a Question

Working with Fbx32

Fbx32 Antibody Images (1)
Western Blot analysis of FBXO32 expression in transfected 293T cell line by FBXO32 MaxPab polyclonal antibody.

Lane 1: FBXO32 transfected lysate(39.05 KDa).
Lane 2: Non-transfected lysate.
Reviews (0)  Have you used this product? Review this product to earn Novus Rewards.

Ask a Scientist

Can't find an answer to your question about Fbx32? Ask us by using live chat or by submitting your questions below:

 
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, Secondary Antibodies

Related Products

Lysates (2)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Fbx32 LysateNBL1-10632WB(1)

Fbx32 LysateH00114907-T01WB

Peptides and Proteins
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Fbx32 Recombinant ProteinH00114907-P01HuELISA, WB(1)

Primary Antibodies (6)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Fbx32 AntibodyNBP1-36955Bv, Hu, Mu, Po, RtPEP-ELISA, WB(1)

Fbx32 AntibodyPAB15627Bv, Hu, Mu, RtELISA, WB

Fbx32 AntibodyNBP1-79517Hu, MuWB

Fbx32 AntibodyNBP1-79516HuWB

Fbx32 Antibody (1D6)H00114907-M02HuELISA

Secondary Antibodies
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Mouse IgG Antibody [Biotin]NB720-BMuELISA, IHC-P, WB

Mouse IgG Antibody [HRP]NB720-HMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [Alkaline Phosphatase]NB720-APMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [FITC]NB720-FMuICC, IHC-P(2)

Mouse IgG AntibodyNB120-7056Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-)ELISA, IHC-P, IP, WB

See All »

Jump to: Novus Explorer

Fbx32 in Context


Novus Explorer for Fbx32 gene

Try our bioinformatic tool that shows the relationships between FBXO32 and other genes, diseases, pathways and post-translational modifications.