Fatty Acid Synthase Antibody (H00002194-D01P)
Fatty Acid Synthase Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-Fas antibody, anti-OA-519 antibody, anti-MGC15706 antibody, anti-MGC14367 antibody, |
|
|
Fatty Acid Synthase Antibody Summary: | | Gene: | FASN |
|---|
| Purity: | Protein A purified |
|---|
| Host: | Rabbit |
|---|
| | Specificity: | FASN - fatty acid synthase, |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional Fatty Acid Synthase Products Fatty Acid Synthase Antibody Details: | Immunogen: | FASN (AAH07909.1, 1 a.a. ~ 439 a.a) full-length human protein. |
|---|
| Epitope: | MSTNDTIVSGTLPQRMASCLEVLDLFLNQP HMVLSSFVLAEKAAAYRDRDSQRDLVEAVA HILGIRDLAAVNLDSSLADLGLDSLMSVEV RQTLERELNLVLSVREVRQLTLRKLQELSS KADEASELACPTPKEDGLAQQQTQLNLRSL LVNPEGPTLMRLNSVQSSERPLFLVHPIEG STTVFHSLASRLSIPTYGLQCTRAAPLDSI HSLAAYYIDCIRQVQPEGPYRVAGYSYGAC VAFEMCSQLQAQQSP |
|---|
| Uses: | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
|---|
| Dilutions: | Western Blot 1:500,
ELISA |
|---|
| Unit Size: | 0.1 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | In 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: The enzyme encoded by this gene is a multifunctional protein. Its main function is to catalyze the synthesis of palmitate from acetyl-CoA and malonyl-CoA, in the presence of NADPH, into long-chain saturated fatty acids. In some cancer cell lines, this protein has been found to be fused with estrogen receptor-alpha (ER-alpha), in which the N-terminus of FAS is fused in-frame with the C-terminus of ER-alpha. [provided by RefSeq]
|
Images (1) Reviews (0) Related Products (21) Exploring Fatty Acid Synthase
|
Jump to: Images, Ask a Question
|
Working with Fatty Acid Synthase
Fatty Acid Synthase Antibody Images (1) Western Blot analysis of FASN expression in transfected 293T cell line by FASN MaxPab rabbit polyclonal antibody.
Lane 1: FASN transfected lysate(48.30 KDa).
Lane 2: Non-transfected lysate.
|
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about Fatty Acid Synthase? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Antibody Pairs, Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsAntibody Pairs (2)Lysates (2)Peptides and ProteinsPrimary Antibodies (14)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Fatty Acid Synthase Antibody | NB400-114 | Ch, Hu, Mk, Mu, Po, Rt | IHC, IHC-P, IP, WB | (3) | (7) | | | | Fatty Acid Synthase Antibody (3F2-1F3) | H00002194-M01 | Hu | ELISA, IF, IHC-P, WB | (4) | (1) | | | | Fatty Acid Synthase Antibody | NB100-87029 | Hu, Mu | IF, IHC-P | (3) | | | | | Fatty Acid Synthase Antibody | NBP1-84733 | Hu | IF, IHC-P, WB | (3) | | | | | Fatty Acid Synthase Antibody | PAB12142 | Ch, Hu, Mu, Po, Rt | IHC-P, IP, WB | | | | | | ... and 9 more. See All » |
RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Rabbit IgG Antibody [HRP] | NB730-H | Rb | ELISA, ICC, IHC-P, WB | | (5) | | | | Rabbit IgG Antibody [FITC] | NB730-F | Rb | ICC, IHC-P | | (1) | | | | Rabbit IgG Antibody [Biotin] | NB730-B | Rb | ELISA, ICC, IHC-P, WB | | | | | | Rabbit IgG, H/L Chains Antibody [DyLight 488] | NBP1-72944 | Rb | FLISA, IF, WB | (3) | | | | | Rabbit IgG Antibody [Alkaline Phosphatase] | NB730-AP | Rb | ELISA, ICC, IHC-P, WB | | (1) | | | | See All » |
|
Jump to: Novus Explorer, Research Areas
| Fatty Acid Synthase in Context
Research Areas related to Fatty Acid Synthase (1): |
|
Novus Explorer for Fatty Acid Synthase gene
|
|
