Fatty Acid Synthase Antibody (H00002194-M01)

Fatty Acid Synthase Antibody (3F2-1F3)

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax
Loading...
Loading...Unit Size: 0.05 mg
 
Bulk Request
Fatty Acid Synthase Antibody (3F2-1F3) Summary:
Species:Hu
Applications:ELISA, IF, IHC-P, WB
Clonality:Monoclonal
Gene:FASN
Purity:IgG purified
Host:Mouse
Specificity:FASN - fatty acid synthase
Publications:Antibody has been mentioned in at least 1 Publication.
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional Fatty Acid Synthase Products
Fatty Acid Synthase Antibody (3F2-1F3) Details:
Clone:3F2-1F3
Isotype:IgG1 Kappa
Immunogen:FASN (AAH07909, 1 a.a. ~ 440 a.a) full length recombinant protein with GST tag.
Epitope:MSTNDTIVSGTLPQRMASCLEVLDLFLNQP HMVLSSFVLAEKAAAYRDRDSQRDLVEAVA HILGIRDLAAVNLDSSLADLGLDSLMSVEV RQTLERELNLVLSVREVRQLTLRKLQELSS KADEASELACPTPKEDGLAQQQTQLNLRSL LVNPEGPTLMRLNSVQSSERPLFLVHPIEG STTVFHSLASRLSIPTYGLQCTRAAPLDSI HSLAAYYIDCIRQVQPEGPYRVAGYSYGAC VAFEMCSQLQAQQSP
Species Reactivity:

Human. Other species not tested.

Applications:
Uses:Antibody reactive against recominant protein and cell lysate for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA.
Dilutions:ELISA, immunofluorescence, Immunohistochemistry-Paraffin, Western Blot 1:500
Unit Size:0.05 mg
Concentration:Please see the vial label for concentration.
Notes:
This product is produced by and distributed for Abnova, a company based in Taiwan.
Packaging:
Storage:Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:In 1x PBS, pH 7.2
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: FASN
Entrez2194 (Human)
OMIM600212 (Human)
Swiss ProtAAH07909 (Human)
 
Background:

The enzyme encoded by this gene is a multifunctional protein. Its main function is to catalyze the synthesis of palmitate from acetyl-CoA and malonyl-CoA, in the presence of NADPH, into long-chain saturated fatty acids. In some cancer cell lines, this protein has been found to be fused with estrogen receptor-alpha (ER-alpha), in which the N-terminus of FAS is fused in-frame with the C-terminus of ER-alpha.

Jump to: Publications, Images, Ask a Question

Working with Fatty Acid Synthase

Fatty Acid Synthase Antibody (3F2-1F3) Images (4)
Western Blot analysis of FASN expression in transfected 293T cell line by FASN monoclonal antibody (M01), clone 3F2-1F3.

Lane 1: FASN transfected lysate(48.3 KDa).
Lane 2: Non-transfected lysate.
Immunoperoxidase of monoclonal antibody to FASN ( Cat # H00002194-M01 ) on formalin-fixed paraffin-embedded human breast cancer tissue. [antibody concentration 10ug/ml]
Immunofluorescence of monoclonal antibody to FASN (H00002194-M01) on HeLa cell . [antibody concentration 10 ug/ml]FASN monoclonal antibody (M01), clone 3F2-1F3 Western Blot analysis of FASN expression in 293 ( Cat # L026V1 ).
Reviews (0)  Have you used this product? Review this product to earn Novus Rewards.

Publications (1)

Ask a Scientist

Can't find an answer to your question about Fatty Acid Synthase? Ask us by using live chat or by submitting your questions below:

 
Jump to: Antibody Pairs, Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies

Related Products

Antibody Pairs (2)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Fatty Acid Synthase Antibody PairH00002194-PW1HuIP, WB

Fatty Acid Synthase Antibody PairH00002194-AP11HuELISA(1)

Lysates (2)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Fatty Acid Synthase LysateL088T6HuIP, WB(2)

Fatty Acid Synthase LysateH00002194-T01HuWB(2)

Peptides and Proteins
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Fatty Acid Synthase Partial Recombinant ProteinH00002194-Q01HuELISA, WB(1)

Fatty Acid Synthase Recombinant ProteinH00002194-P01HuELISA, WB(1)

Primary Antibodies (13)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Fatty Acid Synthase AntibodyNB400-114Ch, Hu, Mk, Mu, Po, RtIHC, IHC-P, IP, WB(3)(7)

Fatty Acid Synthase AntibodyNB100-87029Hu, MuIF, IHC-P(3)

Fatty Acid Synthase AntibodyNBP1-84733HuIF, IHC-P, WB(3)

Fatty Acid Synthase AntibodyH00002194-B01PHuELISA, IF, WB(3)

Fatty Acid Synthase Antibody (3B3-1D6)H00002194-M02HuELISA, IF, WB(2)

... and 8 more. See All »
RNAi (1)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Fatty Acid Synthase RNAiH00002194-R01Hu(1)(4)

Secondary Antibodies
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Mouse IgG Antibody [Biotin]NB720-BMuELISA, IHC-P, WB

Mouse IgG Antibody [HRP]NB720-HMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [Alkaline Phosphatase]NB720-APMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [FITC]NB720-FMuICC, IHC-P(2)

Mouse IgG AntibodyNB120-7056Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-)ELISA, IHC-P, IP, WB

See All »

Jump to: Novus Explorer, Research Areas

Fatty Acid Synthase in Context


Research Areas related to Fatty Acid Synthase (1):
Novus Explorer for Fatty Acid Synthase gene

Try our bioinformatic tool that shows the relationships between FASN and other genes, diseases, pathways and post-translational modifications.