Fas Antibody (H00000355-D01P)

Fas Antibody

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax
Loading...
Loading...Unit Size: 0.1 mg
 
Bulk Request
Fas Antibody Summary:
Species:Hu
Applications:ELISA, WB
Clonality:Polyclonal
Gene:FAS
Purity:Protein A purified
Host:Rabbit
Specificity:FAS - Fas (TNF receptor superfamily, member 6),
 
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional Fas Products
Fas Antibody Details:
Immunogen:FAS (NP_000034.1, 1 a.a. ~ 335 a.a) full-length human protein.
Epitope:MLGIWTLLPLVLTSVARLSSKSVNAQVTDI NSKGLELRKTVTTVETQNLEGLHHDGQFCH KPCPPGERKARDCTVNGDEPDCVPCQEGKE YTDKAHFSSKCRRCRLCDEGHGLEVEINCT RTQNTKCRCKPNFFCNSTVCEHCDPCTKCE HGIIKECTLTSNTKCKEEGSRSNLGWLCLL LLPIPLIVWVKRKEVQKTCRKHRKENQGSH ESPTLNPETVAINLSDVDLSKYITTIAGVM TLSQVKGFVRKNGVN
Species Reactivity:

Human.

Applications:
Uses:Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.
Dilutions:Western Blot 1:500, ELISA
Unit Size:0.1 mg
Concentration:Please see the vial label for concentration.
Notes:
This product is produced by and distributed for Abnova, a company based in Taiwan.
Packaging:
Storage:Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:In 1x PBS, pH 7.2
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: FAS
Entrez355 (Human)
Swiss ProtNP_000034.1 (Human)
 
Background:

The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor contains a death domain. It has been shown to play a central role in the physiological regulation of programmed cell death, and has been implicated in the pathogenesis of various malignancies and diseases of the immune system. The interaction of this receptor with its ligand allows the formation of a death-inducing signaling complex that includes Fas-associated death domain protein (FADD), caspase 8, and caspase 10. The autoproteolytic processing of the caspases in the complex triggers a downstream caspase cascade, and leads to apoptosis. This receptor has been also shown to activate NF-kappaB, MAPK3/ERK1, and MAPK8/JNK, and is found to be involved in transducing the proliferating signals in normal diploid fibroblast and T cells. At least eight alternatively spliced transcript variants encoding seven distinct isoforms have been described. The isoforms lacking the transmembrane domain may negatively regulate the apoptosis mediated by the full length isoform. [provided by RefSeq]

Jump to: Images, Ask a Question

Working with Fas

Fas Antibody Images (2)
Western Blot analysis of FAS expression in transfected 293T cell line by FAS MaxPab rabbit polyclonal antibody.

Lane 1: FAS transfected lysate(37.70 KDa).
Lane 2: Non-transfected lysate.
FAS MaxPab rabbit polyclonal antibody. Western Blot analysis of FAS expression in A-431.
Reviews (0)  Have you used this product? Review this product to earn Novus Rewards.

Ask a Scientist

Can't find an answer to your question about Fas? Ask us by using live chat or by submitting your questions below:

 
Jump to: Antibody Pairs, Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies

Related Products

Antibody Pairs (3)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Fas Antibody PairH00000355-PW1HuIP, WB

Fas [p Tyr291] Antibody PairDP0119HuPLA(4)

Fas Antibody PairH00000355-AP51HuELISA

Lysates (3)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Fas LysateH00000355-T01HuWB(2)

Fas LysateNBL1-10598WB(1)

Fas LysateNBL1-10599WB(1)

Peptides and Proteins
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Fas Recombinant ProteinH00000355-P01HuELISA, WB(1)

Fas Partial Recombinant ProteinH00000355-Q01HuELISA, WB(1)

Fas ProteinH00000355-G01HuFunc

Fas ProteinNBP1-94195Hu, Mu

Primary Antibodies (52)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Fas AntibodyNBP1-41407Mu, RtICC, IF, IHC-Fr, IHC-P, IP, WB(2)

Fas AntibodyNBP1-89034HuIF, IHC-P, WB(3)

Fas Antibody (DX3)NBP1-28536HuFACS, IHC-Fr, In vitro, IP(1)(5)

Fas Antibody (DX2)NBP1-28532HuFACS, IHC-Fr, In vitro, IP(1)(5)

Fas AntibodyNBP1-49957HuIP, WB(1)

... and 47 more. See All »
RNAi (8)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Fas RNAiH00000355-R14Hu(1)(4)

Fas RNAiH00000355-R13Hu(1)(4)

Fas RNAiH00000355-R16Hu(1)(4)

Fas RNAiH00000355-R11Hu(1)(4)

Fas RNAiH00000355-R12Hu(1)(4)

... and 3 more. See All »
Secondary Antibodies
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Rabbit IgG Antibody [HRP]NB730-HRbELISA, ICC, IHC-P, WB(5)

Rabbit IgG Antibody [FITC]NB730-FRbICC, IHC-P(1)

Rabbit IgG Antibody [Biotin]NB730-BRbELISA, ICC, IHC-P, WB

Rabbit IgG, H/L Chains Antibody [DyLight 488]NBP1-72944RbFLISA, IF, WB(3)

Rabbit IgG Antibody [Alkaline Phosphatase]NB730-APRbELISA, ICC, IHC-P, WB(1)

See All »

Jump to: Novus Explorer, Research Areas

Fas in Context


Research Areas related to Fas (3):
Novus Explorer for Fas gene

Try our bioinformatic tool that shows the relationships between FAS and other genes, diseases, pathways and post-translational modifications.