Factor I Antibody (H00003426-B01)

Factor I Antibody

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax
Loading...
Loading...Unit Size: 0.05 ml
 
Bulk Request
Factor I Antibody Summary:
Species:Hu
Applications:ELISA, WB
Clonality:Polyclonal
Gene:CFI
Purity:Whole antisera
Host:Mouse
Specificity:IF - I factor (complement),
 
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional Factor I Products
Factor I Antibody Details:
Immunogen:IF (-, 1 a.a. ~ 377 a.a) full-length human protein.
Epitope:MKLLHVFLLFLCFHLRFCKVTYTSQEDLVE KKCLAKKYTHLSCDKVFCQPWQRCIEGTCV CKLPYQCPKNGTAVCATNRRSFPTYCQQKS LECLHPGTKFLNNGTCTAEGKFSVSLKHGN TDSEGIVEVKLVDQDKTMFICKSSWSMREA NVACLDLGFQQGADTQRRFKLSDLSINSTE CLHVHCRGLETSLAECTFTKRRTMGYQDFA DVVCYTQKADSPMDDFFQCVNGKYISQMKA CDGINDCGDQSDELC
Species Reactivity:

Human.

Applications:
Uses:Antibody reactive against Tissue Lysate and Transfected Lysate on Western Blot. It has also been used for ELISA.
Dilutions:Western Blot 1:500, ELISA
Unit Size:0.05 ml
Concentration:This product is unpurified. Concentration is not relevant.
Notes:
This product is produced by and distributed for Abnova, a company based in Taiwan.
Packaging:
Storage:Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:This is unpurified antiserum so it is not possible to supply the specific antibody concentration.
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: CFI
Entrez3426 (Human)
Swiss ProtAAH20718.1 (Human)
 
Background:

This gene encodes a serine proteinase that is essential for regulating the complement cascade. The encoded preproprotein is cleaved to produce both heavy and light chains, which are linked by disulfide bonds to form a heterodimeric glycoprotein. This heterodimer can cleave and inactivate the complement components C4b and C3b, and it prevents the assembly of the C3 and C5 convertase enzymes. Defects in this gene cause complement factor I deficiency, an autosomal recessive disease associated with a susceptibility to pyogenic infections. Mutations in this gene have been associated with a predisposition to atypical hemolytic uraemic syndrome, a disease characterized by acute renal failure, microangiopathic hemolytic anemia and thrombocytopenia. Primary glomerulonephritis with immmune deposits is another condition associated with mutation of this gene.

Jump to: Images, Ask a Question

Working with Factor I

Factor I Antibody Images (2)
IF MaxPab polyclonal antibody. Western Blot analysis of IF expression in human kidney.Western Blot analysis of IF expression in transfected 293T cell line by IF MaxPab polyclonal antibody (B01).

Lane 1: IF transfected lysate(42.40 KDa).
Lane 2: Non-transfected lysate.
Reviews (0)  Have you used this product? Review this product to earn Novus Rewards.

Ask a Scientist

Can't find an answer to your question about Factor I? Ask us by using live chat or by submitting your questions below:

 
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies

Related Products

Lysates (2)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Factor I LysateH00003426-T01HuWB(2)

Factor I LysateH00003426-T02WB

Peptides and Proteins
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Factor I Partial Recombinant ProteinH00003426-Q01HuELISA, WB(1)

Primary Antibodies (14)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Factor I AntibodyNBP1-88267HuIF, IHC-P, WB(2)

Factor I AntibodyNBP1-88268HuIF, IHC-P, WB(1)

Factor I Antibody (OX-21)NBP1-02915HuELISA, FACS, IHC-P, IP, WB(1)

Factor I Antibody (OX-21)MAB7963HuELISA, FACS, IHC-P, IP, WB

Factor I AntibodyH00003426-B01PHuELISA, WB(2)

... and 9 more. See All »
RNAi (1)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Factor I RNAiH00003426-R02Hu(1)(4)

Secondary Antibodies
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Mouse IgG Antibody [Biotin]NB720-BMuELISA, IHC-P, WB

Mouse IgG Antibody [HRP]NB720-HMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [Alkaline Phosphatase]NB720-APMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [FITC]NB720-FMuICC, IHC-P(2)

Mouse IgG AntibodyNB120-7056Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-)ELISA, IHC-P, IP, WB

See All »

Jump to: Novus Explorer

Factor I in Context


Novus Explorer for Factor I gene

Try our bioinformatic tool that shows the relationships between CFI and other genes, diseases, pathways and post-translational modifications.