FXR Antibody (H00009971-M01)

FXR Antibody (1G11)

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax
Loading...
Loading...Unit Size: 0.1 mg
 
Bulk Request
FXR Antibody (1G11) Summary:
Species:Hu
Applications:ELISA, IF, WB
Clonality:Monoclonal
Gene:NR1H4
Purity:IgG purified
Host:Mouse
Specificity:NR1H4 - nuclear receptor subfamily 1, group H, member 4
 
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional FXR Products
FXR Antibody (1G11) Details:
Clone:1G11
Isotype:IgG1 Kappa
Immunogen:NR1H4 (NP_005114, 363 a.a. ~ 473 a.a) partial recombinant protein with GST tag.
Epitope:TPMFSFYKSIGELKMTQEEYALLTAIVILS PDRQYIKDREAVEKLQEPLLDVLQKLCKIH QPENPQHFACLLGRLTELRTFNHHHAEMLM SWRVNDHKFTPLLCEIWDVQ*
Species Reactivity:

Human. Other species not tested.

Applications:
Uses:Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA.
Dilutions:ELISA, immunofluorescence, Western Blot 1:500
Unit Size:0.1 mg
Concentration:Please see the vial label for concentration.
Notes:
This product is produced by and distributed for Abnova, a company based in Taiwan.
Packaging:
Storage:Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:In 1x PBS, pH 7.2
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: NR1H4
Entrez9971 (Human)
OMIM603826, (Human)
Swiss ProtNP_005114 (Human)
 
Jump to: Images, Ask a Question

Working with FXR

FXR Antibody (1G11) Images (3)
Immunofluorescence of monoclonal antibody to NR1H4 (H00009971-M01) on HepG2 cell . [antibody concentration 10 ug/ml]NR1H4 monoclonal antibody (M01), clone 1G11. Western Blot analysis of NR1H4 expression in A-431 ( Cat # L015V1 ).
NR1H4 monoclonal antibody (M01), clone 1G11 Western Blot analysis of NR1H4 expression in HepG2 ( Cat # L019V1 ).
Reviews (0)  Have you used this product? Review this product to earn Novus Rewards.

Ask a Scientist

Can't find an answer to your question about FXR? Ask us by using live chat or by submitting your questions below:

 
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies

Related Products

Lysates (1)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
FXR LysateNBL1-13769WB(1)

Peptides and Proteins
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
FXR Partial Recombinant ProteinH00009971-Q01HuELISA, WB(1)

Primary Antibodies (14)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
FXR AntibodyNB400-153HuWB(1)

FXR AntibodyNBP1-91914HuIF, IHC-P, WB(1)

FXR Antibody (1B10)H00009971-M02HuELISA, IF, WB(3)

FXR AntibodyNB100-55416HuPEP-ELISA, WB(1)(1)

FXR AntibodyNBP1-52830HuWB(1)

... and 9 more. See All »
RNAi (1)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
FXR RNAiH00009971-R01Hu(1)(4)

Secondary Antibodies
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Mouse IgG Antibody [Biotin]NB720-BMuELISA, IHC-P, WB

Mouse IgG Antibody [HRP]NB720-HMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [Alkaline Phosphatase]NB720-APMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [FITC]NB720-FMuICC, IHC-P(2)

Mouse IgG AntibodyNB120-7056Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-)ELISA, IHC-P, IP, WB

See All »

Jump to: Novus Explorer

FXR in Context


Novus Explorer for FXR gene

Try our bioinformatic tool that shows the relationships between NR1H4 and other genes, diseases, pathways and post-translational modifications.