FOXO3A Antibody (H00002309-M08)

FOXO3A Antibody (4F2)

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax
Loading...
Loading...Unit Size: 0.1 mg
 
Bulk Request
FOXO3A Antibody (4F2) Summary:
Species:Hu
Applications:ELISA, IHC-P, WB
Clonality:Monoclonal
Gene:FOXO3
Purity:IgG purified
Host:Mouse
Specificity:FOXO3A (4F2)
 
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional FOXO3A Products
FOXO3A Antibody (4F2) Details:
Clone:4F2
Isotype:IgG2a Kappa
Immunogen:FOXO3A (AAH21224, 361 a.a. ~ 460 a.a) partial recombinant protein with GST tag.
Epitope:PCTVELPRLTDMAGTMNLNDGLTENLMDDL LDNITLPPSQPSPTGGLMQRSSSFPYTTKG SGLGSPTSSFNSTVFGPSSLNSLRQSPMQT IQENKPATFS
Species Reactivity:

Human. Other species not tested.

Applications:
Uses:Antibody reactive against recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.
Dilutions:ELISA, Immunohistochemistry-Paraffin, Western Blot 1:500
Unit Size:0.1 mg
Concentration:Please see the vial label for concentration.
Notes:
This product is produced by and distributed for Abnova, a company based in Taiwan.
Packaging:
Storage:Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:In 1x PBS, pH 7.2
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: FOXO3
Entrez2309 (Human)
OMIM602681, (Human)
Swiss ProtAAH21224 (Human)
 
Background:

This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. This gene likely functions as a trigger for apoptosis through expression of genes necessary for cell death. Translocation of this gene with the MLL gene is associated with secondary acute leukemia. Alternatively spliced transcript variants encoding the same protein have been observed.

Jump to: Images, Ask a Question

Working with FOXO3A

FOXO3A Antibody (4F2) Images (2)
Immunoperoxidase of monoclonal antibody to FOXO3A ( Cat # H00002309-M08 ) on formalin-fixed paraffin-embedded human colon adenocarcinoma. [antibody concentration 1 ug/ml]Detection limit for recombinant GST tagged FOXO3A is approximately 1ng/ml as a capture antibody.
Reviews (0)  Have you used this product? Review this product to earn Novus Rewards.

Ask a Scientist

Can't find an answer to your question about FOXO3A? Ask us by using live chat or by submitting your questions below:

 
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies

Related Products

Lysates (1)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
FOXO3A LysateNBL1-10814WB(1)

Peptides and Proteins
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
FOXO3A Partial Recombinant ProteinH00002309-Q01HuELISA, WB(1)

FOXO3A Recombinant ProteinH00002309-P01HuELISA, WB(1)

FOXO3A PeptideNB100-1438PEPPEP-ELISA

FOXO3A PeptideNBP1-77380PEPHuB/N

Primary Antibodies (31)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
FOXO3A AntibodyNBP1-39764Bv, Ca, Ch, Hu, Mk, Mu, Rt, XpIHC-P, WB(1)

FOXO3a Antibody (EPR1950)NBP1-95465Hu, Mu, RtICC, IF, WB(2)

FOXO3A Antibody (EP1949Y)NB110-56994Hu, Mu(-), Rt(-)ICC, IHC-P, WB(2)(3)

FOXO3A AntibodyNB100-614Dr(-), HuIP, WB(1)

FOXO3A AntibodyNB100-613Dr(-), HuIP, WB(1)

... and 26 more. See All »
RNAi (2)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
FOXO3A RNAiH00002309-R01Hu(1)(4)

FOXO3A RNAiH00002309-R02Hu(1)(4)

Secondary Antibodies
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Mouse IgG Antibody [Biotin]NB720-BMuELISA, IHC-P, WB

Mouse IgG Antibody [HRP]NB720-HMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [Alkaline Phosphatase]NB720-APMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [FITC]NB720-FMuICC, IHC-P(2)

Mouse IgG AntibodyNB120-7056Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-)ELISA, IHC-P, IP, WB

See All »

Jump to: Novus Explorer, Research Areas

FOXO3A in Context


Research Areas related to FOXO3A (4):
Novus Explorer for FOXO3A gene

Try our bioinformatic tool that shows the relationships between FOXO3 and other genes, diseases, pathways and post-translational modifications.