FOXO3A Antibody (H00002309-M07)
FOXO3A Antibody (2C4)
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-AF6q21 antibody, anti-Forkhead (Drosophila) homolog (rhabdomyosarcoma) like 1 antibody, anti-FKHRL1P2 antibody, anti-FKHRL1 antibody, anti-FKHR2 antibody, anti-DAF16 antibody, |
|
|
FOXO3A Antibody (2C4) Summary: | | Gene: | FOXO3 |
|---|
| Purity: | IgG purified |
|---|
| Host: | Mouse |
|---|
| | | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional FOXO3A Products FOXO3A Antibody (2C4) Details: | Clone: | 2C4 |
|---|
| Isotype: | IgG2a Kappa |
|---|
| Immunogen: | FOXO3A (AAH21224, 361 a.a. ~ 460 a.a) partial recombinant protein with GST tag. |
|---|
| Epitope: | PCTVELPRLTDMAGTMNLNDGLTENLMDDL LDNITLPPSQPSPTGGLMQRSSSFPYTTKG SGLGSPTSSFNSTVFGPSSLNSLRQSPMQT IQENKPATFS |
|---|
Human. Other species not tested. |
| Uses: | Antibody reactive against recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
|---|
| Dilutions: | ELISA,
Immunohistochemistry-Paraffin,
Western Blot 1:500 |
|---|
| Unit Size: | 0.1 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | In 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. This gene likely functions as a trigger for apoptosis through expression of genes necessary for cell death. Translocation of this gene with the MLL gene is associated with secondary acute leukemia. Alternatively spliced transcript variants encoding the same protein have been observed.
|
Images (2) Reviews (0) Related Products (46) Exploring FOXO3A
|
Jump to: Images, Ask a Question
|
Working with FOXO3A
FOXO3A Antibody (2C4) Images (2) Immunoperoxidase of monoclonal antibody to FOXO3A ( Cat # H00002309-M07 ) on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 1.5 ug/ml] |  Detection limit for recombinant GST tagged FOXO3A is approximately 0.3ng/ml as a capture antibody. |
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about FOXO3A? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsLysates (1)Peptides and ProteinsPrimary Antibodies (31)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| FOXO3A Antibody | NBP1-39764 | Bv, Ca, Ch, Hu, Mk, Mu, Rt, Xp | IHC-P, WB | (1) | | | | | FOXO3a Antibody (EPR1950) | NBP1-95465 | Hu, Mu, Rt | ICC, IF, WB | (2) | | | | | FOXO3A Antibody (EP1949Y) | NB110-56994 | Hu, Mu(-), Rt(-) | ICC, IHC-P, WB | (2) | (3) | | | | FOXO3A Antibody | NB100-614 | Dr(-), Hu | IP, WB | (1) | | | | | FOXO3A Antibody | NB100-613 | Dr(-), Hu | IP, WB | (1) | | | | | ... and 26 more. See All » |
RNAi (2)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
