FBXO3 Antibody 0.05 ml

FBXO3 H00026273-B01

Contact Information

Choose a country to view pricing and purchasing information.

More on H00026273-B01

Ordering Information

Catalog Number  H00026273-B01

Availability  Discontinued

Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

Or feel free to contact us for alternative products.

View other FBXO3 Products
View other FBXO3 Primary Antibodies

FBXO3 Antibody Summary

 
Species Human
Tested Applications WB, ELISA
Clonality Polyclonal
Host Mouse
Gene FBXO3
Purity Whole antisera
Specificity FBXO3 - F-box protein 3,
Guarantee Plus All of our products are backed by our 100% guarantee to work for stated and predicted species and applications.
Innovator's Reward Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

FBXO3 Antibody Details

 
Immunogen FBXO3 (-, 1 a.a. ~ 471 a.a) full-length human protein.MAAMETETAPLTLESLPTDPLLLILSFLDYRDLINC CYVSRRLSQLSSHDPLWRRHCKKYWLISEEEKTQKNQCWKSLFI DTYSDVGRYIDHYAAIKKAWDDLKKYLEPRCPRMVLSLKEGARE EDLDAVEAQIGCKLPDDYRCSYRIHNGQKLVVPGLLGSMALSNH YRSEDLLDVDTAAGGFQQRQGLKYCLPLTFCIHTGLSQYIAVEA AEGRNKNEVFYQCPDQMARNPAAIDMFIIGATFTDWFTSYVKN

Species Reactivity

 
Human.

Applications/Dilutions

 
Dilutions
  • Western Blot 1:500
  • ELISA
Application Notes

Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Product PDFs

Reviews

Earn rewards points by submitting your review for FBXO3 Antibody (H00026273-B01).
Submit a Review

Publications

Earn rewards if you have published using FBXO3 Antibody (H00026273-B01).
Submit a Publication

Protocols and FAQs

Controls & Support Products

Research Tools

View all FBXO3 Research Tools.

Notes

 
This product is produced by and distributed for Abnova, a company based in Taiwan.

Packaging, Storage & Formulations

 
Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer This antibody is in antisera and the concentration is unavailable.
Unit Size 0.05 ml
Concentration This product is unpurified. The exact concentration of antibody is not quantifiable.
Preservative No Preservative
Limitations This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

 
Gene Symbol FBXO3
Entrez
Uniprot

Alternate Names for FBXO3

 
  • F-box protein FBX3
  • DKFZp564B092
  • FBX3FBAF-box only protein 3
  • F-box protein 3

Related Products by Gene

Background

 
This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. Alternative splicing of this gene generates 2 transcript variants diverging at the 3' end.