Egr1 Antibody (H00001958-M04)

Egr1 Antibody (4G7)

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax
Loading...
Loading...Unit Size: 0.1 mg
 
Bulk Request
Egr1 Antibody (4G7) Summary:
Species:Hu
Applications:ELISA, WB
Clonality:Monoclonal
Gene:EGR1
Purity:IgG purified
Host:Mouse
Specificity:EGR1 - early growth response 1
 
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional Egr1 Products
Egr1 Antibody (4G7) Details:
Clone:4G7
Isotype:IgG1 Kappa
Immunogen:EGR1 (NP_001955, 444 a.a. ~ 544 a.a) partial recombinant protein with GST tag.
Epitope:SPVATSYPSPVTTSYPSPATTSYPSPVPTS FSSPGSSTYPSPVHSGFPSPSVATTYSSVP PAFPAQVSSFPSSAVTNSFSASTGLSDMTA TFSPRTIEIC*
Species Reactivity:

Human. Other species not tested.

Applications:
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Dilutions:ELISA, Western Blot 1:500
Unit Size:0.1 mg
Concentration:Please see the vial label for concentration.
Notes:
This product is produced by and distributed for Abnova, a company based in Taiwan.
Packaging:
Storage:Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:In 1x PBS, pH 7.2
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: EGR1
Entrez1958 (Human)
OMIM128990, (Human)
Swiss ProtNP_001955 (Human)
 
Background:

The protein encoded by this gene belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a transcriptional regulator. The products of target genes it activates are required for differentitation and mitogenesis. Studies suggest this is a cancer suppresor gene.

Jump to: Images, Ask a Question

Working with Egr1

Egr1 Antibody (4G7) Images (1)
Detection limit for recombinant GST tagged EGR1 is approximately 0.3ng/ml as a capture antibody.
Reviews (0)  Have you used this product? Review this product to earn Novus Rewards.

Ask a Scientist

Can't find an answer to your question about Egr1? Ask us by using live chat or by submitting your questions below:

 
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies

Related Products

Lysates (1)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Egr1 LysateNBL1-10157WB(1)

Peptides and Proteins
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Egr1 Partial Recombinant ProteinH00001958-Q01HuELISA, WB(1)

Primary Antibodies (16)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Egr1 Antibody (6E8)H00001958-M03HuELISA, IF, IHC-P, WB(4)(1)

Egr1 AntibodyNBP1-78775Hu, MuIP, WB

Egr1 AntibodyH00001958-A01HuELISA, WB(3)

Egr1 AntibodyNBP1-67866Hu, Mu, RtELISA, WB(1)

Egr1 AntibodyNBP1-78776MuWB

... and 11 more. See All »
RNAi (1)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Egr1 RNAiH00001958-R01Hu(1)(4)

Secondary Antibodies
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Mouse IgG Antibody [Biotin]NB720-BMuELISA, IHC-P, WB

Mouse IgG Antibody [HRP]NB720-HMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [Alkaline Phosphatase]NB720-APMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [FITC]NB720-FMuICC, IHC-P(2)

Mouse IgG AntibodyNB120-7056Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-)ELISA, IHC-P, IP, WB

See All »

Jump to: Novus Explorer, Research Areas

Egr1 in Context


Research Areas related to Egr1 (4):
Novus Explorer for Egr1 gene

Try our bioinformatic tool that shows the relationships between EGR1 and other genes, diseases, pathways and post-translational modifications.