Egr1 Antibody (H00001958-M07)
Egr1 Antibody (3G3)
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-AT225 antibody, anti-ZNF225 antibody, anti-ZIF-268 antibody, anti-TIS8 antibody, anti-NGFI-A antibody, anti-KROX-24 antibody, anti-G0S30 antibody, |
|
|
Egr1 Antibody (3G3) Summary: | | Gene: | EGR1 |
|---|
| Purity: | IgG purified |
|---|
| Host: | Mouse |
|---|
| | Specificity: | EGR1 - early growth response 1 |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional Egr1 Products Egr1 Antibody (3G3) Details: | Clone: | 3G3 |
|---|
| Isotype: | IgG1 Kappa |
|---|
| Immunogen: | EGR1 (NP_001955, 444 a.a. ~ 544 a.a) partial recombinant protein with GST tag. |
|---|
| Epitope: | SPVATSYPSPVTTSYPSPATTSYPSPVPTS FSSPGSSTYPSPVHSGFPSPSVATTYSSVP PAFPAQVSSFPSSAVTNSFSASTGLSDMTA TFSPRTIEIC* |
|---|
Human. Other species not tested. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
|---|
| Dilutions: | ELISA,
Western Blot 1:500 |
|---|
| Unit Size: | 0.1 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | In 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: The protein encoded by this gene belongs to the EGR family of C2H2-type zinc-finger proteins. It is a nuclear protein and functions as a transcriptional regulator. The products of target genes it activates are required for differentitation and mitogenesis. Studies suggest this is a cancer suppresor gene.
|
Images (2) Reviews (0) Related Products (19) Exploring Egr1
|
Jump to: Images, Ask a Question
|
Working with Egr1
Egr1 Antibody (3G3) Images (2) EGR1 monoclonal antibody (M07), clone 3G3 Western Blot analysis of EGR1 expression in Hela NE ( Cat # L013V3 ). |  Detection limit for recombinant GST tagged EGR1 is approximately 0.3ng/ml as a capture antibody. |
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about Egr1? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsLysates (1)Peptides and ProteinsPrimary Antibodies (15)RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
