We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human ERK1 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related ERK1 Peptides and Proteins

Order Details


    • Catalog Number
      H00005595-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human ERK1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acids 279-379 of Human MAPK3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:NYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERLKELIFQETARFQPGVLEAP

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
MAPK3

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ERK1 Protein

  • EC 2.7.11
  • ERK1
  • ERK-1
  • ERK1p44-MAPK
  • ERT2
  • Extracellular signal-regulated kinase 1
  • extracellular signal-related kinase 1
  • HS44KDAP
  • HUMKER1A
  • Insulin-stimulated MAP2 kinase
  • MAP kinase 1
  • MAP kinase 3
  • MAP kinase isoform p44
  • MAPK 1
  • MAPK 3
  • MAPK3
  • MGC20180
  • Microtubule-associated protein 2 kinase
  • Mitogen-activated protein kinase 1
  • mitogen-activated protein kinase 3
  • P44ERK1
  • p44-ERK1
  • p44mapk
  • PRKM3
  • PRKM3EC 2.7.11.24

Background

MAPK3 - mitogen-activated protein kinase 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP1-47833
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
AF8691
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
H00005706-M02
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, KD, WB
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-37568
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-00764
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
H00010598-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP1-81575
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-68874
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
236-EG
Species: Hu
Applications: BA
NBP2-50037
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB

Publications for ERK1 Partial Recombinant Protein (H00005595-Q01) (0)

There are no publications for ERK1 Partial Recombinant Protein (H00005595-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ERK1 Partial Recombinant Protein (H00005595-Q01) (0)

There are no reviews for ERK1 Partial Recombinant Protein (H00005595-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ERK1 Partial Recombinant Protein (H00005595-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ERK1 Products

Research Areas for ERK1 Partial Recombinant Protein (H00005595-Q01)

Find related products by research area.

Blogs on ERK1.


  Read full blog post.


  Read full blog post.

The role of c-Fos in the regulation of the JC virus gene transcription
c-Fos is a member of the AP-1 transcription factor family under the Fos protein family umbrella, alongside Fra-1, Fra-2 and Fos-B.  Also in the AP-1 transcription family are the Jun proteins, c-Jun, Jun-B and Jun-D.  Each member of the AP-1 transcri...  Read full blog post.

The effects of curcumin on IKB Alpha and the NFkB signaling pathway
The IKK complex, or inhibitor of NFkB kinase, is composed of IKK alpha and IKK beta.  These kinases are at the core of the NFkB signaling cascade.  The NFkB family is made up of transcription factors that are kept inactive in the cytoplasm through...  Read full blog post.

MAPK3/ERK1 - A signal transduction pathway with roles in development and disease
Mitogen-activated protein kinases (MAPKs) are important signaling proteins needed to transmit and relay extracellular stimuli and to illicit intracellular responses (1). The MAPK family of proteins are serine/threonine kinases that are able to phos...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ERK1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MAPK3