ERK1 Antibody (H00005595-M04)
ERK1 Antibody (1F7)
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-ERK1 antibody, anti-PRKM3 antibody, anti-P44MAPK antibody, anti-P44ERK1 antibody, |
|
|
ERK1 Antibody (1F7) Summary: | | Gene: | MAPK3 |
|---|
| Purity: | IgG purified |
|---|
| Host: | Mouse |
|---|
| | Specificity: | MAPK3 - mitogen-activated protein kinase 3 (1F7) |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional ERK1 Products ERK1 Antibody (1F7) Details: | Clone: | 1F7 |
|---|
| Isotype: | IgG2a Kappa |
|---|
| Immunogen: | MAPK3 (AAH13992, 279 a.a. ~ 379 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
|---|
| Epitope: | NYLQSLPSKTKVAWAKLFPKSDSKALDLLD RMLTFNPNKRITVEEALAHPYLEQYYDPTD EPVAEEPFTFAMELDDLPKERLKELIFQET ARFQPGVLEAP |
|---|
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
|---|
| Dilutions: | ELISA,
Western Blot 1:500 |
|---|
| Unit Size: | 0.1 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | In 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: The protein encoded by this gene is a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act in a signaling cascade that regulates various cellular processes such as proliferation, differentiation, and cell cycle progression in response to a variety of extracellular signals. This kinase is activated by upstream kinases, resulting in its translocation to the nucleus where it phosphorylates nuclear targets. Alternatively spliced transcript variants encoding different protein isoforms have been described. [provided by RefSeq]
|
Images (4) Reviews (0) Related Products (45) Exploring ERK1
|
Jump to: Antibody Pairs, Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsAntibody Pairs (1)Lysates (2)Peptides and ProteinsPrimary Antibodies (36)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| ERK1 Antibody (3C9) | H00005595-M01 | Hu | ELISA, IF, IHC-P, WB | (5) | | | | | ERK1 Antibody (Y72) | NB110-56979 | Hu | FACS, ICC, IHC-P, IP, WB | (2) | (1) | | | | ERK1 Antibody | NBP1-84807 | Hu | IF, IHC-P, WB | (2) | | | | | ERK1 Antibody | NBP1-84808 | Hu | IF, IHC-P, WB | (2) | | | | | ERK1 [p Thr202, p Tyr204] Antibody | NB500-141 | Hu, Rt | IHC-P, WB | (1) | | | | | ... and 31 more. See All » |
RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
