| Description | A partial recombinant protein corresponding to the amino acids 971 - 1023 of Human EGF Source: Escherichia coli Amino Acid Sequence:MNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR |
| Preparation Method |
Escherichia coli expression system |
| Details of Functionality | The ED50 for this effect is < 0.89 ng/mL . Measured in a cell proliferation assay using mouse Balb3T3 cell. |
| Protein/Peptide Type | Recombinant Protein |
| Gene | EGF |
| Dilutions |
|
| Application Notes | This product is useful for and SDS-PAGE and Functional assays. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | In PBS, pH 7.4 |
| Preservative | No Preservative |
Research Areas for EGF Recombinant Protein (P3451)Find related products by research area.
|
|
Using EGF Protein from Novus Biologicals EGF (epidermal growth factor) stimulates differentiation, proliferation and cell growth by binding to its receptor, EGFR. EGF was first discovered in the mouse submandibular gland in 1986 by Stanley Cohen of Vanderbilt University, leading to a Nobel P... Read full blog post. |
|
Myosin is More than Just a Heavy Lifter Myosin is a well-known, hexameric molecular motor that is a key cytoskeletal component. It consists of a pair of myosin heavy chain subunits (MHC), a pair of essential myosin light chain subunits (MLC), and a pair of regulatory light chain subunits (R... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | EGF |