EGF Protein (NBC1-18456)
EGF Protein
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-Epidermal growth factor antibody, |
|
|
EGF Protein Summary: | | | | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional EGF Products EGF Protein Details: | Immunogen: | MNSDSECPLSHDGYCLHDGVCMYIEALDKY ACNCVVGYIGERCQYRDLKWWELR |
|---|
| Uses: | This product is useful for ELISA and SDS-Page. The purity of this protein is > 95% by SDS - PAGE. This recombinant protein was expressed in E.Coli bacteria. The endotoxin levels of this protein have not yet been determined. |
|---|
| Dilutions: | ELISA, SDS-Page |
|---|
| Unit Size: | 0.1 mg |
|---|
| Concentration: | 1.0 mg/ml |
|---|
|
Packaging: | Storage: | Store at -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | Liquid. In phosphate-buffered saline(PBS), pH 7.4 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: Recombinant human epidermal growth factor(EGF) is a 6.3 kDa globular protein containing 54 amino acids residues, including 3 intra-molecular disulfide bonds. EGF is a potent growth factor that stimulates the proliferation of various epidermal and epithelial cells. Additionally, EGF has been shown to inhibit gastric secretion, and to be involved in wound healing. EGF signals through a receptor known as c-erbB, which is a class I tyrosine kinase receptor. Recombinant EGF was expressed in E.coli and purified by conventional column chromatography, after refolding of the isolated inclusion bodies in a renaturation buffer.
|
Images (1) Reviews (0) Related Products (33) Exploring EGF Working with EGF
|
Jump to: Publications, Images, Ask a Question
|
Working with EGF
EGF Protein Images (1) SDS-Page: EGF Protein [NBC1-18456] - EGF, 6.3kDa (54aa), confirmed by MALDI-TOF with a purity of 95% by SDS - PAGE |
|
|
|
Publications (1)EGF Protein Background References:- Riese., et al (1998 ) Bioessays. 20: 41-48.Cohen S., (1983) Cancer. 15: 1787-1791.Carpenter G., et al (1979) Annu. Rev. Biochem., 48: 193-216.
|
|
|
|
Ask a Scientist
Can't find an answer to your question about EGF? Ask us by using live
chat or by submitting your questions below:
|
|
