E2F4 Antibody (H00001874-D01P)

E2F4 Antibody

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax
Loading...
Loading...Unit Size: 0.1 mg
 
Bulk Request
E2F4 Antibody Summary:
Species:Hu
Applications:ELISA, WB
Clonality:Polyclonal
Gene:E2F4
Purity:Protein A purified
Host:Rabbit
Specificity:E2F4 - E2F transcription factor 4, p107/p130-binding,
 
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional E2F4 Products
E2F4 Antibody Details:
Immunogen:E2F4 (NP_001941.2, 1 a.a. ~ 413 a.a) full-length human protein.
Epitope:MAEAGPQAPPPPGTPSRHEKSLGLLTTKFV SLLQEAKDGVLDLKLAADTLAVRQKRRIYD ITNVLEGIGLIEKKSKNSIQWKGVGPGCNT REIADKLIELKAEIEELQQREQELDQHKVW VQQSIRNVTEDVQNSCLAYVTHEDICRCFA GDTLLAIRAPSGTSLEVPIPEGLNGQKKYQ IHLKSVSGPIEVLLVNKEAWSSPPVAVPVP PPEDLLQSPSAVSTPPPLPKPALAQSQEAS RPNSPQLTPTAVPGS
Species Reactivity:

Human.

Applications:
Uses:Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.
Dilutions:Western Blot 1:500, ELISA
Unit Size:0.1 mg
Concentration:Please see the vial label for concentration.
Notes:
This product is produced by and distributed for Abnova, a company based in Taiwan.
Packaging:
Storage:Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:In 1x PBS, pH 7.2
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: E2F4
Entrez1874 (Human)
Swiss ProtNP_001941.2 (Human)
 
Background:

The protein encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein binds to all three of the tumor suppressor proteins pRB, p107 and p130, but with higher affinity to the last two. It plays an important role in the suppression of proliferation-associated genes, and its gene mutation and increased expression may be associated with human cancer. [provided by RefSeq]

Jump to: Images, Ask a Question

Working with E2F4

E2F4 Antibody Images (2)
Western Blot analysis of E2F4 expression in transfected 293T cell line by E2F4 MaxPab rabbit polyclonal antibody.

Lane 1: E2F4 transfected lysate(44.00 KDa).
Lane 2: Non-transfected lysate.
E2F4 MaxPab rabbit polyclonal antibody. Western Blot analysis of E2F4 expression in mouse spleen.
Reviews (0)  Have you used this product? Review this product to earn Novus Rewards.

Ask a Scientist

Can't find an answer to your question about E2F4? Ask us by using live chat or by submitting your questions below:

 
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies

Related Products

Lysates (3)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
E2F4 LysateH00001874-T01HuWB(2)

E2F4 LysateNBL1-10085WB(1)

E2F4 LysateH00001874-T02WB

Peptides and Proteins
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
E2F4 Recombinant ProteinH00001874-P01HuELISA, WB(1)

Primary Antibodies (10)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
E2F4 AntibodyNBP1-21374Hu, MuIHC-P, IP, WB(2)

E2F4 AntibodyNBP1-67548Hu, Mu, RtELISA, IHC, WB(2)

E2F4 Antibody (SPM179)NB120-17845Hu, RtIF, IHC-P, WB(1)

E2F4 AntibodyNBP1-21373HuIP(1)

E2F4 Antibody (TFE42)NBP1-54516Hu, Mu, RtIP, WB

... and 5 more. See All »
RNAi (1)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
E2F4 RNAiH00001874-R01Hu(1)(4)

Secondary Antibodies
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Rabbit IgG Antibody [HRP]NB730-HRbELISA, ICC, IHC-P, WB(5)

Rabbit IgG Antibody [FITC]NB730-FRbICC, IHC-P(1)

Rabbit IgG Antibody [Biotin]NB730-BRbELISA, ICC, IHC-P, WB

Rabbit IgG, H/L Chains Antibody [DyLight 488]NBP1-72944RbFLISA, IF, WB(3)

Rabbit IgG Antibody [Alkaline Phosphatase]NB730-APRbELISA, ICC, IHC-P, WB(1)

See All »

Jump to: Novus Explorer, Research Areas

E2F4 in Context


Research Areas related to E2F4 (1):
Novus Explorer for E2F4 gene

Try our bioinformatic tool that shows the relationships between E2F4 and other genes, diseases, pathways and post-translational modifications.