E2F4 Antibody (H00001876-M01)

E2F4 Antibody (2B6-G9)

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax
Loading...
Loading...Unit Size: 0.1 mg
 
Bulk Request
E2F4 Antibody (2B6-G9) Summary:
Species:Hu
Applications:ELISA, WB
Clonality:Monoclonal
Gene:E2F4
Purity:IgG purified
Host:Mouse
Specificity:E2F6 - E2F transcription factor 6
 
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional E2F4 Products
E2F4 Antibody (2B6-G9) Details:
Clone:2B6-G9
Isotype:IgG2a Kappa
Immunogen:E2F6 (AAH08348, 1 a.a. ~ 282 a.a) full length recombinant protein with GST tag.
Epitope:MSQQRPARKLPSLLLDPTEETVRRRCRDPI NVEGLLPSKIRINLEDNVQYVSMRKALKVK RPRFDVSLVYLTRKFMDLVRSAPGGILDLN KVATKLGVRKRRVYDITNVLDGIDLVEKKS KNHIRWIGSDLSNFGAVPQQKKLQEELSDL SAMEDALDELIKDCAQQLFELTDDKENERL AYVTYQDIHSIQAFHEQIVIAVKAPAETRL DVPAPREDSITVHIRSTNGPIDVYLCEVEQ GQTSNKRSEGVGTSS
Species Reactivity:

Human. Other species not tested.

Applications:
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Dilutions:ELISA, Western Blot 1:500
Unit Size:0.1 mg
Concentration:Please see the vial label for concentration.
Notes:
This product is produced by and distributed for Abnova, a company based in Taiwan.
Packaging:
Storage:Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:In 1x PBS, pH 7.2
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: E2F4
Entrez1874 (Human)
OMIM602944 (Human)
Swiss ProtAAH08348 (Human)
 
Background:

This gene encodes a member of the E2F transcription factor protein family. E2F family members play a crucial role in control of the cell cycle and of the action of tumor suppressor proteins. They are also a target of the transforming proteins of small DNA tumor viruses. Many E2F proteins contain several evolutionarily conserved domains: a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. The encoded protein of this gene is atypical because it lacks the transactivation and tumor suppressor protein association domains. It contains a modular suppression domain and is an inhibitor of E2F-dependent transcription. The protein is part of a multimeric protein complex that contains a histone methyltransferase and the transcription factors Mga and Max. Multiple transcript variants have been reported for this gene, but it has not been clearly demonstrated that they encode valid isoforms.

Jump to: Ask a Question

Working with E2F4

E2F4 Antibody (2B6-G9) Images (0)
Reviews (0)  Have you used this product? Review this product to earn Novus Rewards.

Ask a Scientist

Can't find an answer to your question about E2F4? Ask us by using live chat or by submitting your questions below:

 
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies

Related Products

Lysates (3)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
E2F4 LysateH00001874-T01HuWB(2)

E2F4 LysateNBL1-10085WB(1)

E2F4 LysateH00001874-T02WB

Peptides and Proteins
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
E2F4 Recombinant ProteinH00001874-P01HuELISA, WB(1)

Primary Antibodies (10)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
E2F4 AntibodyNBP1-21374Hu, MuIHC-P, IP, WB(2)

E2F4 AntibodyNBP1-67548Hu, Mu, RtELISA, IHC, WB(2)

E2F4 Antibody (SPM179)NB120-17845Hu, RtIF, IHC-P, WB(1)

E2F4 AntibodyNBP1-21373HuIP(1)

E2F4 Antibody (TFE42)NBP1-54516Hu, Mu, RtIP, WB

... and 5 more. See All »
RNAi (1)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
E2F4 RNAiH00001874-R01Hu(1)(4)

Secondary Antibodies
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Mouse IgG Antibody [Biotin]NB720-BMuELISA, IHC-P, WB

Mouse IgG Antibody [HRP]NB720-HMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [Alkaline Phosphatase]NB720-APMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [FITC]NB720-FMuICC, IHC-P(2)

Mouse IgG AntibodyNB120-7056Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-)ELISA, IHC-P, IP, WB

See All »

Jump to: Novus Explorer, Research Areas

E2F4 in Context


Research Areas related to E2F4 (1):
Novus Explorer for E2F4 gene

Try our bioinformatic tool that shows the relationships between E2F4 and other genes, diseases, pathways and post-translational modifications.