DMRT1 Antibody 0.05 ml

DMRT1 H00001761-B01

Contact Information

Choose a country to view pricing and purchasing information.

More on H00001761-B01

  • All DMRT1 Products
  • Alternate Names
     
  • Submit a Review

Ordering Information: H00001761-B01

Catalog NumberH00001761-B01
  • FormUnconjugated
  • Size(s)0.05 ml
  • Price, Shipping
    & Availability
     

     
  •  

DMRT1 Antibody Summary

 
Species Human
Tested Applications WB, ELISA
Clonality Polyclonal
Host Mouse
Gene DMRT1
Purity Whole antisera
Specificity DMRT1 - doublesex and mab-3 related transcription factor 1,
Guarantee Plus All of our products are backed by our 100% guarantee to work for stated and predicted species and applications.
Innovator's Reward Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

DMRT1 Antibody Details

 
Immunogen DMRT1 (-, 1 a.a. ~ 373 a.a) full-length human protein.MPNDEAFSKPSTPSEAPHAPGVPPQGRAGGFGKASG ALVGAASGSSAGGSSRGGGSGSGASDLGAGSKKSPRLPKCARCR NHGYASPLKGHKRFCMWRDCQCKKCNLIAERQRVMAAQVALRRQ QAQEEELGISHPIPLPSAAELLVKRENNGSNPCLMTECSGTSQP PPASVPTTAASEGRMVIQDIPAVTSRGHVENTPDLVSDSTYYSS FYQPSLFPYYNNLYNCPQYSMALAADSASGEVGNPLGGSPVKN

Species Reactivity

 
Human.

Applications/Dilutions

 
Dilutions
  • Western Blot 1:500
  • ELISA
Application Notes

Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Product PDFs

Reviews

Earn rewards points by submitting your review for DMRT1 Antibody (H00001761-B01).
Submit a Review

Publications

Earn rewards if you have published using DMRT1 Antibody (H00001761-B01).
Submit a Publication

Protocols and FAQs

Controls & Support Products

Research Tools

View all DMRT1 Research Tools.

Notes

 
This product is produced by and distributed for Abnova, a company based in Taiwan.

Packaging, Storage & Formulations

 
Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer This is unpurified antiserum so it is not possible to supply the specific antibody concentration.
Unit Size 0.05 ml
Concentration This product is unpurified. The exact concentration of antibody is not quantifiable.
Preservative No Preservative
Limitations This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

 
Gene Symbol DMRT1
Entrez
Uniprot

Alternate Names for DMRT1

 
  • doublesex- and mab-3-related transcription factor 1
  • DM domain expressed in testis 1
  • DMT1DM domain expressed in testis protein 1
  • doublesex and mab-3 related transcription factor 1

Related Products by Gene

Background

 
This gene is found in a cluster with two other members of the gene family, having in common a zinc finger-like DNA-binding motif (DM domain). The DM domain is an ancient, conserved component of the vertebrate sex-determining pathway that is also a key regulator of male development in flies and nematodes. This gene exhibits a gonad-specific and sexually dimorphic expression pattern. Defective testicular development and XY feminization occur when this gene is hemizygous.