DLC1 Antibody (H00010395-B01P)
DLC1 Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-ARHGAP7 antibody, anti-STARD12 antibody, anti-p122-RhoGAP antibody, anti-HP antibody, anti-FLJ21120 antibody, |
|
|
DLC1 Antibody Summary: | | Gene: | DLC1 |
|---|
| Purity: | Protein A purified |
|---|
| Host: | Mouse |
|---|
| | Specificity: | DLC1 - deleted in liver cancer 1, |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional DLC1 Products DLC1 Antibody Details: | Immunogen: | DLC1 (NP_872584.1, 1 a.a. ~ 1528 a.a) full-length human protein. |
|---|
| Epitope: | MSVAIRKRSWEEHVTHWMGQPFNSDDRNTA CHHGLVADSLQASMEKDATLNVDRKEKCVS LPDCCHGSELRDFPGRPMGHLSKDVDENDS HEGEDQFLSLEASTETLVHVSDEDNNADLC LTDDKQVLNTQGQKTSGQHMIQGAGSLEKA LPIIQSNQVSSNSWGIAGETELALVKESGE RKVTDSISKSLELCNEISLSEIKDAPKVNA VDTLNVKDIAPEKQLLNSAVIAQQRRKPDP PKDENERSTCNVVQD |
|---|
| Uses: | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
|---|
| Dilutions: | Western Blot 1:500,
ELISA |
|---|
| Unit Size: | 0.05 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | In 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: This gene is deleted in the primary tumor of hepatocellular carcinoma. It maps to 8p22-p21.3, a region frequently deleted in solid tumors. It is suggested that this gene is a candidate tumor suppressor gene for human liver cancer, as well as for prostate, lung, colorectal, and breast cancers. Alternative splicing at this locus results in several transcript variants encoding different isoforms. [provided by RefSeq]
|
Images (1) Reviews (0) Related Products (16)
|
Jump to: Images, Ask a Question
|
Working with DLC1
DLC1 Antibody Images (1) Western Blot analysis of DLC1 expression in transfected 293T cell line by DLC1 MaxPab polyclonal antibody.
Lane 1: DLC1 transfected lysate(168.08 KDa).
Lane 2: Non-transfected lysate.
|
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about DLC1? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Antibody Pairs, Lysates, Primary Antibodies, Secondary Antibodies
|
Related ProductsAntibody Pairs (1)Lysates (3)Primary Antibodies (12)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| DLC1 Antibody | NBP1-87977 | Hu | IF, IHC-P, WB | (2) | | | | | DLC1 Antibody | NBP1-87978 | Hu | IF, IHC-P, WB | (1) | | | | | DLC1 Antibody | NBP1-88824 | Hu | IF, IHC-P, WB | (1) | | | | | DLC1 Antibody | NB300-917 | Hu, Mu | PEP-ELISA | (1) | (2) | | | | DLC1 Antibody | NBP1-68133 | Hu, Mu, Rt | ELISA, IF, IHC | | | | | | ... and 7 more. See All » |
Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
