Home » Products » Primary Antibodies » DAP1 Antibody (H00001611-M01) (0.1 mg)
 

DAP1 Antibody (H00001611-M01)

DAP1 Antibody (3C5)

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax
Loading...
Loading...Unit Size: 0.1 mg
 
Bulk Request
(see alternate names)
DAP1 Antibody (3C5) Summary:
Species:Hu
Applications:ELISA, WB
Clonality:Monoclonal
Gene:DAP
Purity:IgG purified
Host:Mouse
Specificity:DAP - death-associated protein (3C5)
 
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional DAP1 Products
Peptides and ProteinsPrimary Antibodies
 
» View all DAP1 Related Products
DAP1 Antibody (3C5) Details:
Clone:3C5
Isotype:IgG2a Kappa
Immunogen:DAP (AAH02726, 1 a.a. ~ 103 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Epitope:MSSPPEGKLETKAGHPPAVKAGGMRIVQKH PHTGDTKEEKDKDDQEWESPSPPKPTVFIS GVIARGDKDFPPAAAQVAHQKPHASMDKHP SPRTQHIQQPRK*
Species Reactivity:

Human.

Applications:
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Dilutions:Western Blot 1:500, ELISA
Unit Size:0.1 mg
Concentration:Please see the vial label for concentration.
Notes:
This product is produced by and distributed for Abnova, a company based in Taiwan.
Packaging:
Storage:Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:In 1x PBS, pH 7.2
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: DAP
Entrez1611 (Human)
Swiss ProtAAH02726 (Human)
 
Background:

This gene encodes a basic, proline-rich, 15-kD protein. The protein acts as a positive mediator of programmed cell death that is induced by interferon-gamma. [provided by RefSeq]
Reviews (0)

Be the first to review this product for a reward!

Related Products (6)

1 Peptides and Proteins

5 Primary Antibodies

Secondary Antibodies

Exploring DAP1

1 Related Research Areas
Jump to: Ask a Question

Working with DAP1

DAP1 Antibody (3C5) Images (0)
Reviews (0)  Have you used this product? Review this product to earn Novus Rewards.
Protocols
All General Protocols

Ask a Scientist

Can't find an answer to your question about DAP1? Ask us by using live chat or by submitting your questions below:

 
Jump to: Peptides and Proteins, Primary Antibodies, Secondary Antibodies

Related Products

Peptides and Proteins
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
DAP1 Recombinant ProteinH00001611-P01HuELISA, WB(1)

Primary Antibodies (5)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
DAP1 Antibody (E59)NB110-56925Hu, Mu(-), Rt(-)ICC, IHC-P, IP, WB(3)(1)

DAP1 AntibodyNBP1-91031HuIF, IHC-P, WB(1)

DAP1 AntibodyNBP1-55828Hu, MuELISA, IHC-P(1)

DAP1 AntibodyPAB17532Hu, MuELISA, IHC-P

Secondary Antibodies
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Mouse IgG Antibody [Biotin]NB720-BMuELISA, IHC-P, WB

Mouse IgG Antibody [HRP]NB720-HMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [Alkaline Phosphatase]NB720-APMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [FITC]NB720-FMuICC, IHC-P(2)

Mouse IgG AntibodyNB120-7056Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-)ELISA, IHC-P, IP, WB

See All »
Jump to: Novus Explorer, Research Areas

DAP1 in Context

Research Areas related to DAP1 (1):
Novus Explorer for DAP1 gene
Try our bioinformatic tool that shows the relationships between DAP and other genes, diseases, pathways and post-translational modifications.