DAP Kinase 1 Antibody (H00001612-M01)
DAP Kinase 1 Antibody (2E7)
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-DAPK antibody, anti-DKFZp781I035 antibody, |
|
|
DAP Kinase 1 Antibody (2E7) Summary: | | Gene: | DAPK1 |
|---|
| Purity: | IgG purified |
|---|
| Host: | Mouse |
|---|
| | Specificity: | DAPK1 - death-associated protein kinase 1 |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional DAP Kinase 1 Products DAP Kinase 1 Antibody (2E7) Details: | Clone: | 2E7 |
|---|
| Isotype: | IgG1 Kappa |
|---|
| Immunogen: | DAPK1 (NP_004929, 1211 a.a. ~ 1310 a.a) partial recombinant protein with GST tag. |
|---|
| Epitope: | LLLDSVCSTIENVMATTLPGLLTVKHYLSP QQLREHHEPVMIYQPRDFFRAQTLKETSLT NTMGGYKESFSSIMCFGCHDVYSQASLGMD IHASDLNLLT |
|---|
Human. Other species not tested. |
| Uses: | Antibody reactive against recombinant protein on ELISA. GST alone used as a negative control. |
|---|
| Dilutions: | ELISA |
|---|
| Unit Size: | 0.1 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | In 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: Death-associated protein kinase 1 is a positive mediator of gamma-interferon induced programmed cell death. DAPK1 encodes a structurally unique 160-kD calmodulin dependent serine-threonine kinase that carries 8 ankyrin repeats and 2 putative P-loop consensus sites. It is a tumor suppressor candidate.
|
Images (1) Reviews (0) Related Products (11) Exploring DAP Kinase 1
|
Jump to: Images, Ask a Question
|
Working with DAP Kinase 1
DAP Kinase 1 Antibody (2E7) Images (1) Detection limit for recombinant GST tagged DAPK1 is approximately 0.1ng/ml as a capture antibody. |
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about DAP Kinase 1? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsLysates (1)Peptides and ProteinsPrimary Antibodies (7)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| DAP Kinase 1 Antibody | NBP1-96699 | Hu, Mu, Rt | ICC, IF, IHC-P, WB | (3) | | | | | DAP Kinase 1 Antibody | 28480002 | Hu | ELISA | (1) | | | | | DAP Kinase 1 Antibody | PAB2049 | Hu, Mu | ELISA, IHC-P, WB | | | | | | DAP Kinase 1 [p Ser308] Antibody (DKPS308) | NB120-10524 | Hu | ELISA, IP, WB | | (3) | | | | DAP Kinase 1 Antibody (DKPS308) | MAB7223 | Hu | ELISA, IP, WB | | | | | | ... and 2 more. See All » |
RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
Jump to: Novus Explorer, Research Areas
| DAP Kinase 1 in Context
Research Areas related to DAP Kinase 1 (2): |
|
Novus Explorer for DAP Kinase 1 gene
|
|
