Complement Factor B Antibody 0.1 ml

Click image to view larger
Western Blot: Complement Factor B Antibody [NBP1-89985] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells); Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells).
Immunohistochemistry-Paraffin: Complement Factor B Antibody [NBP1-89985] - Staining of human prostate shows strong cytoplasmic and membranous positivity in glandular cells.
Western Blot: Complement Factor B Antibody [NBP1-89985] - Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line EFO-21<br/>Lane 4: Human cell line A-431<br/>Lane 5: Human liver tissue<br/>Lane 6: Human tonsil tissue
Download Datasheet
See All Related

Ordering Information: NBP1-89985

  • Catalog Number
    NBP1-89985
  • Displayed Format
    Unconjugated
  • Size(s)
    0.1 ml
  • Availability
  • Price
    Shipping
  

Complement Factor B Antibody Summary

Species Human, Mouse, Rat
Tested Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Gene
CFB
Purity
Immunogen affinity purified
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Guarantee Plus
All of our products are backed by our 100% guarantee to work for stated and predicted species and applications.
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Complement Factor B Antibody Details

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KDNEQHVFKVKDMENLEDVFYQMIDESQSLSLCGMVWEHRKGTDYHKQPWQAKISVIRPSKGHESCMGAVVSEYFVLTAAHCFTVDDKEHSIKVSVGGEKRDLEIEVVLFHPNYNINGKKEAGIPEFYDYDVALIKLKNKLKYG

Species Reactivity

Human. Cross-reactivity to Mouse and Rat determined by Western Blot.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
Immunohistochemistry retrieval recommended: HIER pH6
Publications
Read Publications using
NBP1-89985 in the following applications:

    Contact Information

    Product PDFs

    Frequently Purchased Together

    Reviews

    Earn rewards points by submitting your review for Complement Factor B Antibody (NBP1-89985). Be the first to review this product and earn double rewards points!

    Publications

    Complement Factor B Antibody (NBP1-89985) has been mentioned in at least 3 publications.
    Earn rewards if you have published using Complement Factor B Antibody (NBP1-89985).

    Packaging, Storage & Formulations

    Storage
    Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
    Buffer
    PBS, pH 7.2, containing 40% glycerol
    Unit Size
    0.1 ml
    Concentration
    0.1 mg/ml
    Preservative
    0.02% Sodium Azide
    Limitations
    This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

    Bioinformatics

    Gene Symbol CFB

    Alternate Names for Complement Factor B Antibody

    • B-factor, properdin
    • BFAHUS4
    • BFD
    • C3 proaccelerator
    • C3 proactivator
    • C3/C5 convertase
    • complement factor B
    • EC 3.4.21
    • EC 3.4.21.47
    • FB
    • FBI12
    • GBGCFAB
    • Glycine-rich beta glycoprotein
    • glycine-rich beta-glycoprotein
    • H2-Bf
    • PBF2
    • Properdin factor B
    Show More

    Related Products by Gene


    Reviews for Complement Factor B Antibody (NBP1-89985) (0)

    There are no reviews for Complement Factor B Antibody (NBP1-89985).
    By submitting a review earn points towards our Rewards Program.
    • 250 points for product review
    • 500 additional points for an image with your product review
    • Double points (500) if you are the first to review this product
    • Double points (1000) if you are the first to review this product with an image
    Have you used Complement Factor B Antibody (NBP1-89985)? Submit your review and earn rewards points which can be used for merchandise & discounts.
    Points can be redeemed for discounts and gift cards:
    $50/€35/£30/$50CAN Amazon Gift Card1000 Points
    Items ships for Free, please disregard any shipping charges.
    $50/€35/£30/$50CAN Off Purchase (credited after checkout)1000 Points
    Discount is removed from total when the order is processed. The discount will not appear in your shopping cart on check out.

    Publications for Complement Factor B Antibody (NBP1-89985) (3)

    Read what people are writing who have used Complement Factor B Antibody (NBP1-89985).

    Have you published using Complement Factor B Antibody (NBP1-89985)? Submit your review and earn rewards points which can be used for merchandise & discounts.

    Product General Protocols

    Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

    Video Protocols

    WB Video Protocol

    Ask a Scientist

    Submit your question on below.
    During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
    For immediate assistance during business hours M- F (excluding major holidays), please contact us.
    CAPTCHA
    This question is for testing whether or not you are a human visitor and to prevent automated spam submissions.

    FAQs for Complement Factor B (2)

    1. In the immunohistochemistry paraffin section protocol....the PBS buffer....should it be at certain pH?
      • For IHC application, different labs cites the pH of PBS buffer in the range of 7.1 - 7.6 but most commonly used pH is pH 7.4 (this is what we use in our lab). You may use this PBS (pH 7.4) for making permeablization buffer, antibody diluent buffers and for making wash buffer. For more on the protocol that we use in our lab and for IHC-P troubleshooting suggestions, you may visit: IHC-P Protocol and IHC-P Troubleshooting.
    2. I was wondering what does Format 7C mean as far as anitbodies go?
      • 7C is a fluorophore - it is useful for FLOW. The details of the fluor are (A=425, E=500)

    Bioinformatics Tool for Complement Factor B

    Discover related pathways, diseases and genes to Complement Factor B. Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
    Bioinformatics Tool

    PTMs for Complement Factor B

    Learn more about PTMs related to Complement Factor B.

    Blogs on Complement Factor B

    There are no specific blogs for Complement Factor B, but you can read our latest blog posts.