Complement Factor B Antibody 0.1 ml

Complement Factor B NBP1-89985

Contact Information

Choose a country to view pricing and purchasing information.

More on NBP1-89985

  • All Complement Factor B Products
  • 3 Publications
  • Alternate Names
     
  • Submit a Review

Ordering Information: NBP1-89985

Catalog NumberNBP1-89985
  • FormUnconjugated
  • Size(s)0.1 ml
  • Price, Shipping
    & Availability
     

     
  •  

Complement Factor B Antibody Summary

 
Species Human, Mouse, Rat
Tested Applications WB, IHC, IHC-P
Clonality Polyclonal
Host Rabbit
Gene CFB
Purity Immunogen affinity purified
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Guarantee Plus All of our products are backed by our 100% guarantee to work for stated and predicted species and applications.
Innovator's Reward Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Complement Factor B Antibody Details

 
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KDNEQHVFKVKDMENLEDVFYQMIDESQSLSLCGMVWE HRKGTDYHKQPWQAKISVIRPSKGHESCMGAVVSEYFVLTAAHC FTVDDKEHSIKVSVGGEKRDLEIEVVLFHPNYNINGKKEAGIPE FYDYDVALIKLKNKLKYG

Species Reactivity

 
Human. Cross-reactivity to Mouse and Rat determined by Western Blot.

Applications/Dilutions

 
Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes

Immunohistochemistry retrieval recommended: HIER pH6

Product PDFs

Reviews

Earn rewards points by submitting your review for Complement Factor B Antibody (NBP1-89985).
Submit a Review

Publications

Complement Factor B Antibody (NBP1-89985) has been mentioned in at least 3 publications.
Earn rewards if you have published using Complement Factor B Antibody (NBP1-89985).
Submit a Publication

Controls & Support Products

Research Tools

View all Complement Factor B Research Tools.

Packaging, Storage & Formulations

 
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer PBS, pH 7.2, containing 40% glycerol
Unit Size 0.1 ml
Concentration 0.1 mg/ml
Preservative 0.02% Sodium Azide
Limitations This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

 
Gene Symbol CFB

Alternate Names for Complement Factor B

 
  • C3/C5 convertase
  • EC 3.4.21
  • PBF2
  • glycine-rich beta-glycoprotein
  • BFD
  • C3 proactivator
  • Properdin factor B
  • C3 proaccelerator
  • Glycine-rich beta glycoprotein
  • FBI12
  • B-factor, properdin
  • FB
  • H2-Bf
  • GBGCFAB
  • BFAHUS4
  • EC 3.4.21.47
  • complement factor B

Related Products by Gene