Complement Factor B Antibody 0.1 ml

Click image to view larger
Western Blot: Complement Factor B Antibody [NBP1-89985] - Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18Lane 2: Human cell line RT-4Lane 3: Human cell line EFO-21Lane 4: Human cell line A-431Lane 5: Human liver tissueLane 6: Human tonsil tissue
Immunohistochemistry-Paraffin: Complement Factor B Antibody [NBP1-89985] - Staining of human prostate shows strong cytoplasmic and membranous positivity in glandular cells.
Western Blot: Complement Factor B Antibody [NBP1-89985] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells); Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells).
Simple Western: Complement Factor B Antibody [NBP1-89985] - Simple Western lane view shows a specific band for CFB in 0.2 mg/ml of Tonsil lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Simple Western: Complement Factor B Antibody [NBP1-89985] - Electropherogram image(s) of corresponding Simple Western lane view. Complement Factor B antibody was used at 1:20 dilution on Tonsil lysate(s).
Download Datasheet
See All Related

Ordering Information: NBP1-89985

  • Catalog Number
    NBP1-89985
  • Displayed Format
    Unconjugated
  • Size(s)
    0.1 ml
  • Availability
  • Price
    Shipping
  

Complement Factor B Antibody Summary

Species Human, Mouse, Rat
Tested Applications WB, Simple Western, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Gene
CFB
Purity
Immunogen affinity purified
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Guarantee Plus
All of our products are backed by our 100% guarantee to work for stated and predicted species and applications.
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Complement Factor B Antibody Details

Isotype
IgG
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KDNEQHVFKVKDMENLEDVFYQMIDESQSLSLCGMVWEHRKGTDYHKQPWQAKISVIRPSKGHESCMGAVVSEYFVLTAAHCFTVDDKEHSIKVSVGGEKRDLEIEVVLFHPNYNINGKKEAGIPEFYDYDVALIKLKNKLKYG

Species Reactivity

Cross-reactivity to Mouse and Rat determined by Western Blot.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Simple Western 1:20
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
Immunohistochemistry retrieval recommended: HIER pH6. In Simple Western only 10-15 uL of the recommended dilution is used per data point.
Control Peptide
Complement Factor B Protein (NBP1-89985PEP)
Publications
Read Publications using
NBP1-89985 in the following applications:

    Contact Information

    Product PDFs

    Frequently Purchased Together

    Reviews

    Earn rewards points by submitting your review for Complement Factor B Antibody (NBP1-89985). Be the first to review this product and earn double rewards points!

    Publications

    Complement Factor B Antibody (NBP1-89985) has been mentioned in at least 3 publications.
    Earn rewards if you have published using Complement Factor B Antibody (NBP1-89985).

    Packaging, Storage & Formulations

    Storage
    Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
    Buffer
    PBS, pH 7.2, containing 40% glycerol
    Unit Size
    0.1 ml
    Concentration
    0.1 mg/ml
    Preservative
    0.02% Sodium Azide
    Limitations
    This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

    Bioinformatics

    Gene Symbol CFB

    Alternate Names for Complement Factor B Antibody

    • BF
    • BFD
    • C3/C5 convertase
    • CFAB
    • CFB
    • GBG
    • H2-Bf
    • PBF2
    • B-factor, properdin
    • BFAHUS4
    • BFD
    • C3 proaccelerator
    • C3 proactivator
    • C3/C5 convertase
    • complement factor B
    • EC 3.4.21
    • EC 3.4.21.47
    • FB
    • FBI12
    • GBGCFAB
    • Glycine-rich beta glycoprotein
    • glycine-rich beta-glycoprotein
    • H2-Bf
    • PBF2
    • Properdin factor B
    Show More

    Related Products by Gene


    Reviews for Complement Factor B Antibody (NBP1-89985) (0)

    There are no reviews for Complement Factor B Antibody (NBP1-89985).
    By submitting a review earn points towards our Rewards Program.
    • 250 points for product review
    • 500 additional points for an image with your product review
    • Double points (500) if you are the first to review this product
    • Double points (1000) if you are the first to review this product with an image
    Have you used Complement Factor B Antibody (NBP1-89985)? Submit your review and earn rewards points which can be used for merchandise & discounts.
    Points can be redeemed for discounts and gift cards:
    $50/€35/£30/$50CAN Amazon Gift Card1000 Points
    Items ships for Free, please disregard any shipping charges.
    $50/€35/£30/$50CAN Off Purchase (credited after checkout)1000 Points
    Discount is removed from total when the order is processed. The discount will not appear in your shopping cart on check out.

    Publications for Complement Factor B Antibody (NBP1-89985) (3)

    Read what people are writing who have used Complement Factor B Antibody (NBP1-89985).

    Have you published using Complement Factor B Antibody (NBP1-89985)? Submit your review and earn rewards points which can be used for merchandise & discounts.

    Product General Protocols

    Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

    Video Protocols

    WB Video Protocol

    Ask a Scientist

    Submit your question on below.
    During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
    For immediate assistance during business hours M- F (excluding major holidays), please contact us.
    CAPTCHA
    This question is for testing whether or not you are a human visitor and to prevent automated spam submissions.

    FAQs for Complement Factor B (2)

    1. In the immunohistochemistry paraffin section protocol....the PBS buffer....should it be at certain pH?
      • For IHC application, different labs cites the pH of PBS buffer in the range of 7.1 - 7.6 but most commonly used pH is pH 7.4 (this is what we use in our lab). You may use this PBS (pH 7.4) for making permeablization buffer, antibody diluent buffers and for making wash buffer. For more on the protocol that we use in our lab and for IHC-P troubleshooting suggestions, you may visit: IHC-P Protocol and IHC-P Troubleshooting.
    2. I was wondering what does Format 7C mean as far as anitbodies go?
      • 7C is a fluorophore - it is useful for FLOW. The details of the fluor are (A=425, E=500)

    Customers Who Viewed This Item Also Viewed...

    NB200-540
    Immunocytochemistry/Immunofluorescence: Complement C3 Antibody (11H9) [NB200-540] - C3 protein fragments deposited on  kidney cells of MPL-lpr mouse. Staining with antibody 11H9. Glomerular staining pattern.Immunohistochemistry-Paraffin: Complement C3 Antibody (11H9) [NB200-540] - IHC-P detection of Complement C3 protein in a formalin fixed paraffin embedded tissue section of mouse liver using 1 : 100 dilution of Complement C3 antibody (clone 11H9) NB200-540. Weak but distinct membrane-cytoplasmic immunopositivity was observed in hepatocytes and few cells developed punctate membrane staining. Immunohistochemistry-Paraffin: Complement C3 Antibody (11H9) [NB200-540] - IHC-P detection of Complement C3 protein in a formalin fixed paraffin embedded tissue section of mouse lymph node using 1 : 100 dilution of Complement C3 antibody (clone 11H9) NB200-540. This representative photomicrograph shows a membrane-cytoplasmic immunopositivity in non-germinal center cells, and few cells developed an intense staining for this target protein.

    Rat Monoclonal
    Species Mouse
    Applications WB, Flow, IA...MORE

    1 Publication
    BAF1936

    Goat Polyclonal
    Species Human
    Applications WB

    NBP2-34234
    Immunohistochemistry-Paraffin: Complement C4d Antibody (C4D204) [NBP2-34234] - Formalin-fixed, paraffin-embedded human kidney transplant tissue (20X) stained with Complement 4d MAb (C4D204).Immunohistochemistry-Paraffin: Complement C4d Antibody (C4D204) [NBP2-34234] - Formalin-fixed, paraffin-embedded human kidney transplant tissue (10X) stained with Complement 4d MAb (C4D204).Immunohistochemistry-Paraffin: Complement C4d Antibody (C4D204) [NBP2-34234] - Formalin-fixed, paraffin-embedded human kidney transplant tissue (40X) stained with Complement 4d Ab (C4D204).

    Mouse Monoclonal
    Species Human
    Applications ICC/IF, IHC-Fr, IHC-P

    AF4999
    Western blot shows lysates of Hepa 1‑6 mouse hepatoma cell line and mouse plasma. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Mouse Complement Factor H Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4999) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Complement Factor H at approximately 150 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.Simple Western lane view shows mouse plasma, loaded at 0.2 mg/mL. A specific band was detected for Complement Factor H at approximately 166 kDa (as indicated) using 10 µg/mL of Sheep Anti-Mouse Complement Factor H Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4999) followed by 1:50 dilution of HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.

    Sheep Polyclonal
    Species Mouse
    Applications WB, Simple Western

    NBP2-36776
    Western Blot: hnRNP C1 + C2 Antibody (CL2593) [NBP2-36776] - Lane 1: Marker [kDa]  Lane 2:Human cell line U-251 MGImmunocytochemistry/Immunofluorescence: hnRNP C1 + C2 Antibody (CL2593) [NBP2-36776] - Staining in U251 cell line with Anti-HNRNPC monoclonal antibody, showing distinct nuclear (without nucleoli) staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.Immunohistochemistry: hnRNP C1 + C2 Antibody (CL2593) [NBP2-36776] - Staining in U2OS cell line with Anti-HNRNPC monoclonal antibody, showing distinct nuclear (without nucleoli) staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.

    Mouse Monoclonal
    Species Human
    Applications WB, ICC/IF, IHC

    NBP1-79075
    Immunohistochemistry-Paraffin: Complement C4 Antibody (A24-T) [NBP1-79075] - Complement C4 Antibody (A24-T) Formalin-fixed and paraffin-embedded human transplanted kidney stained with anti-C4d complement antibody shows diffuse strong positive immunostaining of peritubular and glomerular capillaries (A), indicating acute antibody mediated rejection and diffuse strong positive immunostaining of dilated peritubular moderate capillaries (B), indicating acute antibody mediated rejection.

    Rabbit Monoclonal
    Species Human
    Applications IHC, IHC-Fr, IHC-P

    NB200-541
    Western Blot: Complement C4b/d Antibody (16D2) [NB200-541] - Western blot analysis of C4 expression in J774.A1 (A) aand mouse PBL (B) whole cell lysates.

    Rat Monoclonal
    Species Mouse
    Applications WB, ICC/IF, IHC...MORE

    6 Publications
    AF8216
    Western blot shows lysates of human serum, mouse serum, and rat serum. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human/Mouse/Rat Properdin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8216) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Properdin at approximately 53-55 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.

    Sheep Polyclonal
    Species Human, Mouse, Rat
    Applications WB

    NB110-12179

    Mouse Monoclonal
    Species Human
    Applications WB, B/N, ELISA...MORE

    3 Publications
    NBP2-29931
    Western Blot: HLA B7 Antibody [NBP2-29931] - Western blot analysis of HLA-B (arrow) using rabbit polyclonal HLA-B Antibody (N-term) (NBP2-29931  ). 293 cell lysates (2 ug/lane) either nontransfected (Lane 1) or transiently transfected (Lane 2) with the HLA-B gene.Immunohistochemistry-Paraffin: HLA B7 Antibody [NBP2-29931] - Formalin-fixed and paraffin-embedded human hepatocarcinoma reacted with HLA-B Antibody (N-term), which was peroxidase-conjugated to the secondary antibody, followed by DAB staining. This data demonstrates the use of this antibody for immunohistochemistry; clinical relevance has not been evaluated.Flow Cytometry: HLA B7 Antibody [NBP2-29931] - Flow cytometry analysis of HepG2 cells (bottom histogram) compared to a negative control cell (top histogram). FITC-conjugated goat-anti-rabbit secondary antibodies were used for the analysis.

    Rabbit Polyclonal
    Species Human
    Applications WB, Flow, IHC-P

    MAB610
    TNF‑ alpha  was detected in immersion fixed human peripheral blood mononuclear cells (PBMCs) stimulated with LPS and monensin using Mouse Anti-Human TNF‑ alpha  Monoclonal Antibody (Catalog # MAB610) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (yellow; Catalog # NL007) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Non-adherent Cells.Recombinant Human TNF‑ alpha  (Catalog # 210‑TA) induces cytotoxicity in the the L‑929 mouse fibroblast cell line in a dose-dependent manner (orange line). Cytotoxicity elicited by Recombinant Human TNF‑ alpha  (0.75 ng/mL) is neutral­ized (green line) by increasing concentrations of Mouse Anti-Human TNF‑ alpha  Monoclonal Antibody (Catalog # MAB610). The ND50 is typically 0.01‑0.04 µg/mL in the presence of the metabolic inhibitor actinomycin D (1 µg/mL).

    Mouse Monoclonal
    Species Human
    Applications WB, ICC, Neut

    25 Publications
    NB100-64775
    Flow Cytometry: HLA ABC Antibody (W6/32) [NB100-64775] - Staining of normal human peripheral blood cells with Mouse IgG2a K Isotype Control FITC (NBP1-43955) (blue histogram) or Anti-Human HLA-ABC FITC (purple histogram). Cells in the lymphocyte gate were used for analysis.Flow Cytometry: HLA ABC Antibody (W6/32) [NB100-64775] - Staining of human peripheral blood lymphocytes with Mouse anti Human HLA ABC.Flow Cytometry: HLA ABC Antibody (W6/32) [NB100-64775] - Staining of human peripheral blood lymphocytes with Mouse anti Human HLA ABC:Alexa Fluor 488.

    Mouse Monoclonal
    Species Human, Baboon, Bovine...MORE
    Applications ELISA, Flow, Func...MORE

         1 Review

    18 Publications
    NB120-6405
    Immunocytochemistry/Immunofluorescence: MHC Class I Antibody (OX18) [NB120-6405] - PC-12 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-MHC Class I (OX18) NB120-6405 at a 1:100 dilution overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.Flow Cytometry: MHC Class I Antibody (OX18) [NB120-6405] - Staining of rat spleen cells with MOUSE ANTI RAT RT1A ( CLASS I MONOMORPHIC): FITC.

    Mouse Monoclonal
    Species Rat
    Applications ELISA, Flow, ICC/IF...MORE

    9 Publications
    AF1824

    Goat Polyclonal
    Species Human
    Applications WB, IP

    1 Publication
    NBP1-18977
    Immunoprecipitation: FANCA Antibody [NBP1-18977] - Lane 1: The Fanconi anemia core complex was obtained by IP from HeLa nuclear extracts with anti-FANCA under high stringency washing conditions, removing BLM, Topo III alpha, BLAP75 and RPA70 as indicated. L

    Rabbit Polyclonal
    Species Human
    Applications WB, IP

    3 Publications
    NBP2-01743
    Western Blot: Frataxin Antibody (1C12) [NBP2-01743] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Frataxin (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Frataxin.Immunocytochemistry/Immunofluorescence: Frataxin Antibody (1C12) [NBP2-01743] Staining of COS7 cells transiently transfected by pCMV6-ENTRY Frataxin.Immunohistochemistry-Paraffin: Frataxin Antibody (1C12) [NBP2-01743] - Staining of paraffin-embedded Human prostate tissue using anti-Frataxin mouse monoclonal antibody.

    Mouse Monoclonal
    Species Human
    Applications WB, Flow, ICC/IF...MORE

    NBP1-19015
    Western Blot: Glyoxalase I Antibody (Glo1a) [NBP1-19015] - HeLa whole cell extracts.Immunocytochemistry/Immunofluorescence: Glyoxalase I Antibody (Glo1a) [NBP1-19015] - Immunostaining of human retinal endothelial cells. Immunoreactivity for hGlx-1 was detected in human retinal endothelial cells stained with Glo1a mAb using anti mouse IgG Texas Red as secondary Ab. The cells were counter stained with phalloidin (green) and DAPI (blue), nuclear stain. No reactivity was detected in control cells, stained without Go1a mAb. Figure is a representative of 3 independent experiments. Photo courtesy of Dr. Nagaraj, Case Western Reserve University.Simple Western: Glyoxalase I Antibody (Glo1a) [NBP1-19015] - Simple Western lane view shows a specific band for GLO1 in 0.5 mg/ml of HeLa lysate.  This experiment was performed under reducing conditions using the 12-230kDa separation system. * Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody.

    Mouse Monoclonal
    Species Human, Mouse
    Applications WB, Simple Western, ELISA...MORE

    2 Publications
    AF1344
    Western blot shows lysates of human prostate tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human Kallikrein 3/PSA Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1344) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). A specific band was detected for Kallikrein 3/PSA at approximately 31 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.Kallikrein 3/PSA was detected in immersion fixed paraffin-embedded sections of human kidney cancer tissue using Goat Anti-Human Kallikrein 3/PSA Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1344) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific labeling was localized to the cytoplasm of cells in convoluted tubules. View our protocol for Chromogenic IHC Staining of immersion fixed paraffin-embedded Tissue Sections.

    Goat Polyclonal
    Species Human
    Applications WB, IHC, IP

    1 Publication
    NBP1-32391
    Western Blot: Haptoglobin Antibody [NBP1-32391] - (30 ug of whole cell lysate) A: Hela 10% SDS PAGE diluted at 1:5000Immunocytochemistry/Immunofluorescence: Haptoglobin Antibody [NBP1-32391] - Analysis of HeLa, using Haptoglobin antibody at 1:200 dilution.Immunohistochemistry-Paraffin: Haptoglobin Antibody [NBP1-32391] - Paraffin-embedded Normal gastric, using antibody at 1:100 dilution.

    Rabbit Polyclonal
    Species Human
    Applications WB, ICC/IF, IHC...MORE

    Bioinformatics Tool for Complement Factor B

    Discover related pathways, diseases and genes to Complement Factor B. Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
    Bioinformatics Tool

    PTMs for Complement Factor B

    Learn more about PTMs related to Complement Factor B.

    Blogs on Complement Factor B

    There are no specific blogs for Complement Factor B, but you can read our latest blog posts.