| Description | A recombinant protein with a N-terminal GST tagcorresponding to the amino acids 1-88 of Human CDK2 partial ORF Source: Wheat Germ (in vitro) Amino Acid Sequence:QLFRIFRTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL |
| Details of Functionality | This protein is not active and should not be used for experiments requiring activity. |
| Protein/Peptide Type | Partial Recombinant Protein |
| Gene | CDK2 |
| Dilutions |
|
| Application Notes | Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells. |
| Storage | Store at -80C. Avoid freeze-thaw cycles. |
| Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
![Western Blot PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Western_Blot_11082.jpg)
![Immunohistochemistry PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Immunohistochemistry_11144.jpg)
![Immunohistochemistry PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Immunohistochemistry_11480.jpg)
Research Areas for CDK2 Partial Recombinant Protein (H00001017-Q01)Find related products by research area.
|
|
EZH1 has more to offer than gene repression EZH1 is part of the Polycomb-group family of proteins, which are responsible for remodeling chromatin in genes and modulating epigenetic silencing during development. Specifically, EZHI is a component of PRC2, or polycomb repressive complex-2. PR... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CDK2 |
![Western Blot p27/Kip1 [p Thr157] Antibody](https://images.novusbio.com/images2/p27_AF1555_Western_Blot_5119.jpg)
![Western Blot RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Western_Blot_10216.jpg)
![Immunocytochemistry RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Immunocytochemistry_10464.jpg)
![Simple Western RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Simple_Western_16629.jpg)
![Western Blot CIB1 Antibody (791119) [Unconjugated]](https://images.novusbio.com/images2/CIB1_MAB7557_Western_Blot_13865.jpg)
![Immunohistochemistry CIB1 Antibody (791119) [Unconjugated]](https://images.novusbio.com/images2/CIB1_MAB7557_Immunohistochemistry_13917.jpg)