Cdk2 Antibody (H00001017-M02)
Cdk2 Antibody (2E8)
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-Cdc2 related protein kinase antibody, anti-p33(CDK2) antibody, anti-p33 protein kinase antibody, anti-Cyclin dependent kinase 2 antibody, anti-Cell division protein kinase 2 antibody, anti-Cell division kinase 2 antibody, anti-CDK2 antibody, anti-Cdk 2 antibody, |
|
|
Cdk2 Antibody (2E8) Summary: | | Gene: | CDK2 |
|---|
| Purity: | IgG purified |
|---|
| Host: | Mouse |
|---|
| | Specificity: | CDK2 - cyclin-dependent kinase 2 |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional Cdk2 Products Cdk2 Antibody (2E8) Details: | Clone: | 2E8 |
|---|
| Isotype: | IgG1 Kappa |
|---|
| Immunogen: | CDK2 (AAH03065, 211 a.a. ~ 298 a.a) partial recombinant protein with GST tag. |
|---|
| Localization: | Cytoplasmic and Nuclear |
|---|
| Epitope: | QLFRIFRTLGTPDEVVWPGVTSMPDYKPSF PKWARQDFSKVV
PPLDEDGRSLLSQMLH YDPNKRISAKAALAHPFFQDVTKPVP
HL RL* |
|---|
Human. Other species not tested. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for RNAi validation and ELISA. |
|---|
| Dilutions: | ELISA,
Western Blot 1:500,
RNAi Validation |
|---|
| Unit Size: | 0.1 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | Phosphate buffered saline, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: The protein encoded by this gene is a member of the Ser/Thr protein kinase family. This protein kinase is highly similar to the gene products of S. cerevisiae cdc28, and S. pombe cdc2. It is a catalytic subunit of the cyclin-dependent protein kinase complex, whose activity is restricted to the G1-S phase, and essential for cell cycle G1/S phase transition. This protein associates with and regulated by the regulatory subunits of the complex including cyclin A or E, CDK inhibitor p21Cip1 (CDKN1A) and p27Kip1 (CDKN1B). Its activity is also regulated by its protein phosphorylation. Two alternatively spliced variants and multiple transcription initiation sites of this gene have been reported.
|
Images (5) Reviews (0) Related Products (35) Exploring Cdk2
|
Jump to: Antibody Pairs, Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsAntibody Pairs (3)Lysates (1)Peptides and ProteinsPrimary Antibodies (25)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Cdk2 Antibody (E304) | NB110-55713 | Hu, Mu, Rt | ICC, IP, WB | (2) | (1) | | | | Cdk2 Antibody | NBP1-50240 | Hu, Mu, Rt | ELISA, IF, IHC-P, IP, WB | (1) | | | | | Cdk2 Antibody | NBP1-74562 | Hu, Mu, Rt | ELISA, IHC-P, IP, WB | (2) | (1) | | | | Cdk2 Antibody | NBP1-67886 | Hu, Mu, Rt | ELISA, IF, WB | (2) | | | | | Cdk2 Antibody | NBP1-50241 | Hu, Mu, Xp | ELISA, IHC-P, IP, WB | (1) | | | | | ... and 20 more. See All » |
RNAi (3)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
