CYP27A1 Antibody (H00001593-B01P)
CYP27A1 Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-CP27 antibody, anti-CYP27 antibody, anti-CTX antibody, |
|
|
CYP27A1 Antibody Summary: | | Gene: | CYP27A1 |
|---|
| Purity: | IgG purified |
|---|
| Host: | Mouse |
|---|
| | Specificity: | CYP27A1 - cytochrome P450, family 27, subfamily A, polypeptide 1, |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional CYP27A1 Products CYP27A1 Antibody Details: | Immunogen: | CYP27A1 (NP_000775.1, 1 a.a. ~ 531 a.a) full-length human protein. |
|---|
| Epitope: | MAALGCARLRWALRGAGRGLCPHGARAKAA IPAALPSDKATGAPGAGPGVRRRQRSLEEI PRLGQLRFFFQLFVQGYALQLHQLQVLYKA KYGPMWMSYLGPQMHVNLASAPLLEQVMRQ EGKYPVRNDMELWKEHRDQHDLTYGPFTTE GHHWYQLRQALNQRLLKPAEAALYTDAFNE VIDDFMTRLDQLRAESASGNQVSDMAQLFY YFALEAICYILFEKRIGCLQRSIPEDTVTF VRSIGLMFQNSLYAT |
|---|
| Uses: | Antibody reactive against transfected lysate in western blot. May also be used for ELISA. |
|---|
| Dilutions: | ELISA,
Western Blot 1:500 |
|---|
| Unit Size: | 0.05 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | In 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This mitochondrial protein oxidizes cholesterol intermediates as part of the bile synthesis pathway. Since the conversion of cholesterol to bile acids is the major route for removing cholesterol from the body, this protein is important for overall cholesterol homeostasis. Mutations in this gene cause cerebrotendinous xanthomatosis, a rare autosomal recessive lipid storage disease. [provided by RefSeq]
|
Images (2) Reviews (0) Related Products (12) Exploring CYP27A1
|
Jump to: Images, Ask a Question
|
Working with CYP27A1
CYP27A1 Antibody Images (2) Western Blot analysis of CYP27A1 expression in transfected 293T cell line by CYP27A1 purified MaxPab polyclonal antibody (B01P).
Lane 1: CYP27A1 transfected lysate(60.20 KDa).
Lane 2: Non-transfected lysate.
|  CYP27A1 MaxPab polyclonal antibody. Western Blot analysis of CYP27A1 expression in human liver. |
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about CYP27A1? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsLysates (2)Peptides and ProteinsPrimary Antibodies (8)RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
