Home » CNBP » CNBP Proteins » Recombinant Human CNBP Protein

We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Register on R&D Systems

Recombinant Human CNBP Protein

 Submit a Review

Images

 

Product Details

Summary
Product Discontinued
View other related CNBP Peptides and Proteins

Order Details


    • Catalog Number
      H00007555-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human CNBP Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acids 1-100 of Human ZNF9 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MSSNECFKCGRSGHWARECPTGGGRGRGMRSRGRGFQFVSSSLPDICYRCGESGHLAKDCDLQEDACYNCGRGGHIAKDCKEPKREREQCCYNCGKPGHL
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CNBP

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CNBP Protein

  • CCHC-type zinc finger, nucleic acid binding protein
  • cellular nucleic acid binding protein
  • cellular nucleic acid-binding protein
  • DM2
  • erythroid differentiation-related
  • FLJ11631
  • PROMM
  • RNF163CNBP1ZNF9ZCCHC22
  • sterol regulatory element-binding protein
  • zinc finger protein 273
  • zinc finger protein 9 (a cellular retroviral nucleic acid binding protein)
  • Zinc finger protein 9

Background

This gene encodes a nucleic-acid binding protein with seven zinc-finger domains. The protein has a preference for binding single stranded DNA and RNA. The protein functions in cap-independent translation of ornithine decarboxylase mRNA, and may also function in sterol-mediated transcriptional regulation. A CCTG expansion in the first intron of this gene results in myotonic dystrophy type 2. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DMPK Antibody
NBP1-85010
Immunohistochemistry-Paraffin DMPK Antibody
Immunohistochemistry-Paraffin DMPK Antibody
Immunohistochemistry-Paraffin DMPK Antibody
Species: Hu
Applications: IHC,  IHC-P
SREBP1 Antibody
(2A4) - BSA Free
NB600-582
Western Blot SREBP1 Antibody (2A4) - BSA Free
Western Blot SREBP1 Antibody (2A4) - BSA Free
Western Blot SREBP1 Antibody (2A4) - BSA Free
(73 Publications)
Species: Ca, Ch, SyHa, Ha, Hu, Pm, Mu, Rt
Applications: IHC-Fr, KO, Simple Western, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(31 Publications)
Species: Bv, Hu, Mu
Applications: ICC, IHC
CCT3 Antibody
NBP1-79040
Immunohistochemistry-Paraffin CCT3 Antibody
Western Blot CCT3 Antibody
Immunohistochemistry-Paraffin CCT3 Antibody
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
Fatty Acid
Synthase/FASN Antibod ...
NB400-114
Immunocytochemistry/ Immunofluorescence Fatty Acid Synthase/FASN Antibody - BSA Free
Western Blot Fatty Acid Synthase/FASN Antibody - BSA Free
Immunohistochemistry-Paraffin Fatty Acid Synthase/FASN Antibody - BSA Free
(2 Reviews)
(29 Publications)
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, KD, WB
SREBP2 Antibody
NB100-74543
Western Blot SREBP2 Antibody
Western Blot SREBP2 Antibody
Immunocytochemistry/ Immunofluorescence SREBP2 Antibody
(23 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
ZNF273 Antibody -
BSA Free
NBP2-69045
Immunocytochemistry/ Immunofluorescence ZNF273 Antibody - BSA Free
Species: Hu
Applications: ICC/IF
Muscleblind-like 1
Antibody - BSA Free
NBP2-55165
Immunohistochemistry-Paraffin Muscleblind-like 1 Antibody - BSA Free
Immunohistochemistry-Paraffin Muscleblind-like 1 Antibody - BSA Free
Western Blot Muscleblind-like 1 Antibody - BSA Free
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
PPAR alpha/NR1C1
Antibody (3B6/PPAR) - ...
NB300-537
Flow Cytometry PPAR alpha/NR1C1 Antibody (3B6/PPAR) - BSA Free
Western Blot PPAR alpha/NR1C1 Antibody (3B6/PPAR) - BSA Free
Flow Cytometry PPAR alpha/NR1C1 Antibody (3B6/PPAR) - BSA Free
(1 Review)
(17 Publications)
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
PPAR gamma/NR1C3
Antibody - BSA Free
NBP2-22106
Western Blot PPAR gamma/NR1C3 Antibody - BSA Free
Immunohistochemistry-Paraffin PPAR gamma/NR1C3 Antibody - BSA Free
Western Blot PPAR gamma/NR1C3 Antibody - BSA Free
(2 Reviews)
(12 Publications)
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
Fas/TNFRSF6/CD95
Antibody - BSA Free
NB120-13550
Immunocytochemistry/ Immunofluorescence Fas/TNFRSF6/CD95 Antibody - BSA Free
Western Blot Fas/TNFRSF6/CD95 Antibody - BSA Free
Immunohistochemistry-Paraffin Fas/TNFRSF6/CD95 Antibody - BSA Free
(1 Review)
(4 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
LDLR Antibody
[Unconjugated]
AF2255
Immunohistochemistry LDLR Antibody [Unconjugated]
Western Blot LDLR Antibody [Unconjugated]
Western Blot LDLR Antibody [Unconjugated]
(51 Publications)
Species: Mu
Applications: Block, CyTOF-ready, Flow, IHC, WB
Thyroglobulin
Antibody (2H11 + 6E1)
NBP2-34294
Immunohistochemistry-Paraffin Thyroglobulin Antibody (2H11 + 6E1)
Immunohistochemistry Thyroglobulin Antibody (2H11 + 6E1)
Immunohistochemistry-Paraffin Thyroglobulin Antibody (2H11 + 6E1)
(3 Reviews)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(850 Publications)
Species: Hu
Applications: BA
HMG-CoA
Reductase/HMGCR Antib ...
NBP2-66888
Simple Western HMG-CoA Reductase/HMGCR Antibody (JF0981)
Western Blot HMG-CoA Reductase/HMGCR Antibody (JF0981)
(1 Review)
(7 Publications)
Species: Hu, Mu, Rt
Applications:  IHC-P, IP, Simple Western, WB
Insulin Receptor
beta Antibody - BSA F ...
NBP2-12793
Immunohistochemistry-Paraffin Insulin Receptor beta Antibody - BSA Free
Immunoprecipitation Insulin Receptor beta Antibody - BSA Free
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
Adiponectin/Acrp30
[HRP]
DRP300
N/A Adiponectin/Acrp30 [HRP]
N/A Adiponectin/Acrp30 [HRP]
N/A Adiponectin/Acrp30 [HRP]
(189 Publications)
Species: Hu
Applications: ELISA
Recombinant Human
CNBP Protein
H00007555-Q01
Recombinant Human CNBP Protein
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for CNBP Partial Recombinant Protein (H00007555-Q01) (0)

There are no publications for CNBP Partial Recombinant Protein (H00007555-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CNBP Partial Recombinant Protein (H00007555-Q01) (0)

There are no reviews for CNBP Partial Recombinant Protein (H00007555-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CNBP Partial Recombinant Protein (H00007555-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CNBP Products

Blogs on CNBP

There are no specific blogs for CNBP, but you can read our latest blog posts.

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CNBP Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol CNBP