CHKL Antibody 0.05 mg

CHKL H00001120-B01P

Contact Information

Choose a country to view pricing and purchasing information.

More on H00001120-B01P

  • All CHKL Products
  • Alternate Names
     
  • Submit a Review

Ordering Information: H00001120-B01P

Catalog NumberH00001120-B01P
  • FormUnconjugated
  • Size(s)0.05 mg
  • Price, Shipping
    & Availability
     

     
  •  

CHKL Antibody Summary

 
Species Human
Tested Applications WB, ELISA, ICC/IF
Clonality Polyclonal
Host Mouse
Gene CHKB
Purity Protein A purified
Specificity Reacts with choline kinase beta.
Guarantee Plus All of our products are backed by our 100% guarantee to work for stated and predicted species and applications.
Innovator's Reward Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

CHKL Antibody Details

 
Immunogen CHKB (NP_005189.2, 1 a.a. ~ 395 a.a) full-length human protein.MAAEATAVAGSGAVGGCLAKDGLQQSKCPDTTPKRR RASSLSRDAERRAYQWCREYLGGAWRRVQPEELRVYPVSGGLSN LLFRCSLPDHLPSVGEEPREVLLRLYGAILQGVDSLVLESVMFA ILAERSLGPQLYGVFPEGRLEQYIPSRPLKTQELREPVLSAAIA TKMAQFHGMEMPFTKEPHWLFGTMERYLKQIQDLPPTGLPEMNL LEMYSLKDEMGNLRKLLESTPSPVVFCHNDIQEGNILLLSEPE

Species Reactivity

 
Human

Applications/Dilutions

 
Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes

This antibody is reactive against transfected lysate in western blot, immunofluorescence, and as a detection antibody in ELISA.

Product PDFs

Reviews

Earn rewards points by submitting your review for CHKL Antibody (H00001120-B01P).
Submit a Review

Publications

Earn rewards if you have published using CHKL Antibody (H00001120-B01P).
Submit a Publication

Controls & Support Products

Research Tools

View all CHKL Research Tools.

Notes

 
This product is produced by and distributed for Abnova, a company based in Taiwan.

Packaging, Storage & Formulations

 
Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer 1x PBS, pH 7.4
Unit Size 0.05 mg
Concentration Concentrations vary lot to lot. See vial label for concentration.
Preservative No Preservative
Limitations This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

 
Gene Symbol CHKB
Entrez
Uniprot

Alternate Names for CHKL

 
  • CKB
  • Ethanolamine kinase
  • CK
  • EC 2.7.1.82
  • Ethanolamine kinase beta
  • EC 2.7.1.32
  • Choline kinase-like protein
  • CKEKBEKBcholine/ethanolamine kinase
  • CHKLcholine kinase-like
  • CHETKcholine/ethanolamine kinase beta
  • choline kinase betaEK

Related Products by Gene

Background

 
Choline kinase (CK) and ethanolamine kinase (EK) catalyze the phosphorylation of choline/ethanolamine to phosphocholine/phosphoethanolamine. This is the first enzyme in the biosynthesis of phosphatidylcholine/phosphatidylethanolamine in all animal cells. The highly purified CKs from mammalian sources and their recombinant gene products have been shown to have EK activity also, indicating that both activities reside on the same protein. The choline kinase-like protein encoded by CHKL belongs to the choline/ethanolamine kinase family; however, its exact function is not known. Read-through transcripts are expressed from this locus that include exons from the downstream CPT1B locus. [provided by RefSeq]