CGI-16 Antibody Summary:

Species:	Hu
Applications:	ELISA, WB
Clonality:	Polyclonal

Gene:	ACOT9
Purity:	Whole antisera
Host:	Mouse

Specificity:	ACOT9 - acyl-CoA thioesterase 9,

Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.

View Additional CGI-16 Products

Lysates	Peptides and Proteins
Primary Antibodies	RNAi

» View all CGI-16 Related Products

CGI-16 Antibody Details:

Immunogen:	ACOT9 (1 a.a. ~ 212 a.a) full-length human protein.
Epitope:	MRRAALRLCALGKGQLTPGRGLTQGPQNPK KQGIFHIHEVRDKLREIVGASTNWRDHVKA MEERKLLHSFLAKSQDGLPPRRMKDSYIEV LLPLGSEPELREKYLTVQNTVRFGRILEDL DSLGVLICYMHNKIHSAKMSPLSIVTALVD KIDMCKKSLSPEQDIKFSGHVSWVGKTSME VKMQMFQLHGDEFCPVLDATFVMVARDSEN KG

Species Reactivity:

Human.

Applications:

Uses:	Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.
Dilutions:	Western Blot 1:500, ELISA
Unit Size:	0.05 ml
Concentration:	This product is unpurified. Concentration is not relevant.

Notes:

This product is produced by and distributed for Abnova, a company based in Taiwan.

Packaging:

Storage:	Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:	This is unpurified antiserum so it is not possible to supply the specific antibody concentration.
Preservative:	No Preservative
Limitations:	This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.

Gene Symbol: ACOT9

Entrez	23597 (Human)
Swiss Prot	AAH12573.1 (Human)

Images (1)

See all images...

Reviews (0)

Be the first to review this product for a reward!

Working with CGI-16

CGI-16 Antibody Images (1)

Western Blot analysis of ACOT9 expression in transfected 293T cell line by ACOT9 MaxPab polyclonal antibody (B01).

Lane 1: ACOT9 transfected lysate(24.00 KDa).
Lane 2: Non-transfected lysate.

Reviews (0) Have you used this product? Review this product to earn Novus Rewards.

Protocols

All General Protocols

Ask a Scientist

Can't find an answer to your question about CGI-16? Ask us by using live chat or by submitting your questions below:

Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies

Related Products

Lysates (1)

Name	Catalog#	Reactivity	Applications	Images	Publications	Reviews
CGI-16 Lysate	H00023597-T01		WB

Peptides and Proteins

Name	Catalog#	Reactivity	Applications	Images	Publications	Reviews
CGI-16 Recombinant Protein	H00023597-P01	Hu	ELISA, WB	(1)

Primary Antibodies (6)

Name	Catalog#	Reactivity	Applications	Images
CGI-16 Antibody	NBP1-90275	Hu	IF, IHC-P, WB	(2)
CGI-16 Antibody (4E4)	H00023597-M01	Hu	ELISA, IF, IHC-P, WB	(3)
CGI-16 Antibody (4E4)	NBP1-69886	Hu	ELISA, IF, IHC-P, WB
CGI-16 Antibody	PAB18533	Hu	ELISA, IHC-P, WB
CGI-16 Antibody	NBP1-74084	Hu	WB

RNAi (2)

Name	Catalog#	Reactivity	Applications	Images	Publications	Reviews
CGI-16 RNAi	H00023597-R01	Hu		(1)	(4)
CGI-16 RNAi	H00023597-R02	Hu		(1)	(4)

Secondary Antibodies

Name	Catalog#	Reactivity	Applications	Publications
Mouse IgG Antibody [Biotin]	NB720-B	Mu	ELISA, IHC-P, WB
Mouse IgG Antibody [HRP]	NB720-H	Mu	ELISA, ICC, IHC-P, WB
Mouse IgG Antibody [Alkaline Phosphatase]	NB720-AP	Mu	ELISA, ICC, IHC-P, WB
Mouse IgG Antibody [FITC]	NB720-F	Mu	ICC, IHC-P	(2)
Mouse IgG Antibody	NB120-7056	Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-)	ELISA, IHC-P, IP, WB
See All »

Jump to: Novus Explorer
CGI-16 in Context
Novus Explorer for CGI-16 gene

CGI-16 Antibody (H00023597-B01)

CGI-16 Antibody