CGI-16 Antibody (H00023597-M01)
CGI-16 Antibody (4E4)
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-CGI-16 antibody, anti-MT-ACT48 antibody, |
|
|
CGI-16 Antibody (4E4) Summary: | | Gene: | ACOT9 |
|---|
| Purity: | IgG purified |
|---|
| Host: | Mouse |
|---|
| | Specificity: | ACOT9 - acyl-Coenzyme A thioesterase 2, mitochondrial |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional CGI-16 Products CGI-16 Antibody (4E4) Details: | Clone: | 4E4 |
|---|
| Isotype: | IgG1 Kappa |
|---|
| Immunogen: | ACATE2 (AAH12573, 1 a.a. ~ 213 a.a) full length recombinant protein with GST tag. |
|---|
| Epitope: | MRRAALRLCALGKGQLTPGRGLTQGPQNPK KQGIFHIHEVRDKLREIVGASTNWRDHVKA MEERKLLHSFLAKSQDGLPPRRMKDSYIEV LLPLGSEPELREKYLTVQNTVRFGRILEDL DSLGVLICYMHNKIHSAKMSPLSIVTALVD KIDMCKKSLSPEQDIKFSGHVSWVGKTSME VKMQMFQLHGDEFCPVLDATFVMVARDSEN KG* |
|---|
Human. Other species not tested. |
| Uses: | Antibody reactive against recominant protein and cell lysate for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA. |
|---|
| Dilutions: | ELISA,
immunofluorescence,
Immunohistochemistry-Paraffin,
Western Blot 1:500 |
|---|
| Unit Size: | 0.1 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | In 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
|
Images (3) Reviews (0) Related Products (10)
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsLysates (1)Peptides and ProteinsPrimary Antibodies (6)RNAi (2)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
Jump to: Novus Explorer
| CGI-16 in Context
|
Novus Explorer for CGI-16 gene
|
|
![Immunoperoxidase of monoclonal antibody to ACOT9 ( Cat # H00023597-M01 ) on formalin-fixed paraffin-embedded human heart. [antibody concentration 3ug/ml]](http://images.novusbio.com/images/H00023597-M01-3-3-1-S.jpg "Immunoperoxidase of monoclonal antibody to ACOT9 ( Cat # H00023597-M01 ) on formalin-fixed paraffin-embedded human heart. [antibody concentration 3ug/ml]")
![Immunofluorescence of monoclonal antibody to ACOT9 (H00023597-M01) on HeLa cell . [antibody concentration 10 ug/ml]](http://images.novusbio.com/images/H00023597-M01-4-1-1-S.jpg "Immunofluorescence of monoclonal antibody to ACOT9 (H00023597-M01) on HeLa cell . [antibody concentration 10 ug/ml]")
