We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human CDC42 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related CDC42 Peptides and Proteins

Order Details


    • Catalog Number
      H00000998-P02
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human CDC42 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-191 of Human CDC42 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAGQEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLRDDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPPEPKKSRRCVLL

Protein/Peptide Type
Recombinant Protein
Gene
CDC42

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CDC42 Protein

  • CDC42
  • CDC42Hs
  • cell division control protein 42 homolog
  • cell division cycle 42 (GTP binding protein, 25kDa)
  • cell division cycle 42 (GTP-binding protein, 25kD)
  • dJ224A6.1.1 (cell division cycle 42 (GTP-binding protein, 25kD))
  • dJ224A6.1.2 (cell division cycle 42 (GTP-binding protein, 25kD))
  • G25K GTP-binding protein
  • G25K
  • growth-regulating protein
  • GTP-binding protein, 25kD
  • small GTP binding protein CDC42

Background

The protein encoded by this gene is a small GTPase of the Rho-subfamily, which regulates signaling pathways that control diverse cellular functions including cell morphology, migration, endocytosis and cell cycle progression. This protein is highly similar to Saccharomyces cerevisiae Cdc 42, and is able to complement the yeast cdc42-1 mutant. The product of oncogene Dbl was reported to specifically catalyze the dissociation of GDP from this protein. This protein could regulate actin polymerization through its direct binding to Neural Wiskott-Aldrich syndrome protein (N-WASP), which subsequently activates Arp2/3 complex. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-58359
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
NB100-91273
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB300-996
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
NB110-68800
Species: Hu, Mu, Pm
Applications: ICC/IF, WB
NB100-56159
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
AF6260
Species: Hu
Applications: WB
H00010097-M01
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
NBP1-85802
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-21577
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, WB
H00056731-M02
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP1-82512
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
H00008826-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, S-ELISA, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
H00000998-P02
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for CDC42 Recombinant Protein (H00000998-P02) (0)

There are no publications for CDC42 Recombinant Protein (H00000998-P02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CDC42 Recombinant Protein (H00000998-P02) (0)

There are no reviews for CDC42 Recombinant Protein (H00000998-P02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CDC42 Recombinant Protein (H00000998-P02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CDC42 Products

Research Areas for CDC42 Recombinant Protein (H00000998-P02)

Find related products by research area.

Blogs on CDC42.

The role of Wnts in neuroinflammation
By Michalina Hanzel, PhDThe multifaceted roles of the Wnt family of glycoproteins have been extensively characterized throughout embryonic development and adult homeostasis. The highly conserved, cell- and tissue- s...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CDC42 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CDC42