CDC42 Antibody (H00000998-D01P)
CDC42 Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-CDC42Hs antibody, anti-G25K antibody, |
|
|
CDC42 Antibody Summary: | | Gene: | CDC42 |
|---|
| Purity: | Protein A purified |
|---|
| Host: | Rabbit |
|---|
| | Specificity: | Reacts with cell division cycle 42 (GTP binding protein, 25kDa). |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional CDC42 Products CDC42 Antibody Details: | Immunogen: | CDC42 (NP_001782.1, 1 a.a. ~ 191 a.a) full-length human protein. |
|---|
| Epitope: | MQTIKCVVVGDGAVGKTCLLISYTTNKFPS EYVPTVFDNYAVTVMIGGEPYTLGLFDTAG QEDYDRLRPLSYPQTDVFLVCFSVVSPSSF ENVKEKWVPEITHHCPKTPFLLVGTQIDLR DDPSTIEKLAKNKQKPITPETAEKLARDLK AVKYVECSALTQKGLKNVFDEAILAALEPP EPKKSRRCVLL |
|---|
| Uses: | This antibody is reactive against transfected lysate in western blot, and as a detection antibody in ELISA. |
|---|
| Dilutions: | ELISA,
Western Blot |
|---|
| Unit Size: | 0.1 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Store at -20 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: The protein encoded by this gene is a small GTPase of the Rho-subfamily, which regulates signaling pathways that control diverse cellular functions including cell morphology, migration, endocytosis and cell cycle progression. This protein is highly similar to Saccharomyces cerevisiae Cdc 42, and is able to complement the yeast cdc42-1 mutant. The product of oncogene Dbl was reported to specifically catalyze the dissociation of GDP from this protein. This protein could regulate actin polymerization through its direct binding to Neural Wiskott-Aldrich syndrome protein (N-WASP), which subsequently activates Arp2/3 complex. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq]
|
Images (1) Reviews (0) Related Products (18)
|
Jump to: Images, Ask a Question
|
Working with CDC42
CDC42 Antibody Images (1) Western Blot analysis of CDC42 expression in transfected 293T cell line by CDC42 MaxPab rabbit polyclonal antibody.
Lane 1: CDC42 transfected lysate(21.30 KDa).
Lane 2: Non-transfected lysate.
|
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about CDC42? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsLysates (3)Peptides and ProteinsPrimary Antibodies (8)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| CDC42 Antibody | PAB19100 | Bv, Hu, Mu, Rt | ICC, IHC-Fr, IHC-P, WB | | | | | | CDC42 Antibody | NBP1-45477 | Bv, Hu, Mu, Rt | IHC-P, WB | (1) | | | | | CDC42 Antibody (M152) | MAB1376 | Hu, Mu, Rt | ELISA, ICC, IF, WB | | | | | | CDC42 Antibody | NBP1-76330 | Hu, Mu, Rt | ELISA, WB | (1) | | | | | CDC42 Antibody | NB120-14241 | Hu, Mu, Rt | WB | (1) | (1) | | | | ... and 3 more. See All » |
RNAi (2)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Rabbit IgG Antibody [HRP] | NB730-H | Rb | ELISA, ICC, IHC-P, WB | | (5) | | | | Rabbit IgG Antibody [FITC] | NB730-F | Rb | ICC, IHC-P | | (1) | | | | Rabbit IgG Antibody [Biotin] | NB730-B | Rb | ELISA, ICC, IHC-P, WB | | | | | | Rabbit IgG, H/L Chains Antibody [DyLight 488] | NBP1-72944 | Rb | FLISA, IF, WB | (3) | | | | | Rabbit IgG Antibody [Alkaline Phosphatase] | NB730-AP | Rb | ELISA, ICC, IHC-P, WB | | (1) | | | | See All » |
|
|
