CD44 Antibody (H00000960-B01P)
CD44 Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-CDW44 antibody, anti-PGP1 antibody, anti-MUTCH-I antibody, anti-MIC4 antibody, anti-MGC10468 antibody, anti-MDU3 antibody, anti-MDU2 antibody, anti-MC56 antibody, anti-lhr antibody, anti-IN antibody, anti-ECMR-III antibody, |
|
|
CD44 Antibody Summary: | | Gene: | CD44 |
|---|
| Purity: | Protein A purified |
|---|
| Host: | Mouse |
|---|
| | Specificity: | CD44 - CD44 antigen (Indian blood group), |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional CD44 Products CD44 Antibody Details: | Immunogen: | CD44 (ENSP00000263398, 1 a.a. ~ 361 a.a) full-length human protein. |
|---|
| Marker: | Cell membrane Marker |
|---|
| Epitope: | MDKFWWHAAWGLCLVPLSLAQIDLNITCRF AGVFHVEKNGRYSISRTEAADLCKAFNSTL PTMAQMEKALSIGFETCRYGFIEGHVVIPR IHPNSICAANNTGVYILTSNTSQYDTYCFN ASAPPEEDCTSVTDLPNAFDGPITITIVNR DGTRYVQKGEYRTNPEDIYPSNPTDDDVSS GSSSERSSTSGGYIFYTFSTVHPIPDEDSP WITDSTDRIPATRDQDTFHPSGGSHTTHGS ESDGHSHGSQEGGAN |
|---|
| Uses: | Antibody reactive against tissue lysate and transfected lysate in western blot. May also be used for ELISA and immunohistochemistry-paraffin. |
|---|
| Dilutions: | ELISA,
Western Blot 1:500,
Immunohistochemistry-Paraffin |
|---|
| Unit Size: | 0.05 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | In 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: The protein encoded by this gene is a cell-surface glycoprotein involved in cell-cell interactions, cell adhesion and migration. It is a receptor for hyaluronic acid (HA) and can also interact with other ligands, such as osteopontin, collagens, and matrix metalloproteinases (MMPs). This protein participates in a wide variety of cellular functions including lymphocyte activation, recirculation and homing, hematopoiesis, and tumor metastasis. Transcripts for this gene undergo complex alternative splicing that results in many functionally distinct isoforms, however, the full length nature of some of these variants has not been determined. Alternative splicing is the basis for the structural and functional diversity of this protein, and may be related to tumor metastasis. [provided by RefSeq]
|
Images (4) Reviews (0) Related Products (113) Exploring CD44
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsLysates (3)Peptides and ProteinsPrimary Antibodies (99)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| CD44 Antibody (8E2F3) | NBP1-47386 | Hu, Mu | ELISA, IF, IHC-Fr, IHC-P, WB | (7) | | | | | CD44 Antibody | NBP1-31488 | Hu | ICC, IF, IHC-P, WB | (6) | | | | | CD44 Antibody (IM7) | NBP1-41266 | Ca, Eq, Fe, Hu, Mu | FACS, ICC, IHC-Fr, IHC-P, IP, WB | | | | | | CD44 Antibody (EPR1013Y) | NB110-55700 | Hu, Mu(-), Rt(-) | FACS, ICC, IHC-P, WB | (2) | (3) | | | | CD44 Antibody | NBP1-84578 | Hu | IF, IHC-P, WB | (3) | | | | | ... and 94 more. See All » |
RNAi (5)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
![Immunoperoxidase of <u>purified</u> MaxPab antibody to CD44 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 3 ug/ml]](http://images.novusbio.com/images/H00000960-B01P-3-46-1-S.jpg "Immunoperoxidase of <u>purified</u> MaxPab antibody to CD44 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 3 ug/ml]")
