CD44 Antibody (H00000960-B01P)

CD44 Antibody

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax
Loading...
Loading...Unit Size: 0.05 mg
 
Bulk Request
CD44 Antibody Summary:
Species:Hu
Applications:ELISA, IHC-P, WB
Clonality:Polyclonal
Gene:CD44
Purity:Protein A purified
Host:Mouse
Specificity:CD44 - CD44 antigen (Indian blood group),
 
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional CD44 Products
CD44 Antibody Details:
Immunogen:CD44 (ENSP00000263398, 1 a.a. ~ 361 a.a) full-length human protein.
Marker:Cell membrane Marker
Epitope:MDKFWWHAAWGLCLVPLSLAQIDLNITCRF AGVFHVEKNGRYSISRTEAADLCKAFNSTL PTMAQMEKALSIGFETCRYGFIEGHVVIPR IHPNSICAANNTGVYILTSNTSQYDTYCFN ASAPPEEDCTSVTDLPNAFDGPITITIVNR DGTRYVQKGEYRTNPEDIYPSNPTDDDVSS GSSSERSSTSGGYIFYTFSTVHPIPDEDSP WITDSTDRIPATRDQDTFHPSGGSHTTHGS ESDGHSHGSQEGGAN
Species Reactivity:

Human.

Applications:
Uses:Antibody reactive against tissue lysate and transfected lysate in western blot. May also be used for ELISA and immunohistochemistry-paraffin.
Dilutions:ELISA, Western Blot 1:500, Immunohistochemistry-Paraffin
Unit Size:0.05 mg
Concentration:Please see the vial label for concentration.
Notes:
This product is produced by and distributed for Abnova, a company based in Taiwan.
Packaging:
Storage:Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:In 1x PBS, pH 7.2
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: CD44
Entrez960 (Human)
Swiss ProtENSP00000263398 (Human)
 
Background:

The protein encoded by this gene is a cell-surface glycoprotein involved in cell-cell interactions, cell adhesion and migration. It is a receptor for hyaluronic acid (HA) and can also interact with other ligands, such as osteopontin, collagens, and matrix metalloproteinases (MMPs). This protein participates in a wide variety of cellular functions including lymphocyte activation, recirculation and homing, hematopoiesis, and tumor metastasis. Transcripts for this gene undergo complex alternative splicing that results in many functionally distinct isoforms, however, the full length nature of some of these variants has not been determined. Alternative splicing is the basis for the structural and functional diversity of this protein, and may be related to tumor metastasis. [provided by RefSeq]

Jump to: Images, Ask a Question

Working with CD44

CD44 Antibody Images (4)
Western Blot analysis of CD44 expression in transfected 293T cell line by CD44 MaxPab polyclonal antibody.

Lane 1: CD44 transfected lysate(39.71 KDa).
Lane 2: Non-transfected lysate.
Immunoperoxidase of purified MaxPab antibody to CD44 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 3 ug/ml]
CD44 MaxPab polyclonal antibody. Western Blot analysis of CD44 expression in human spleen.CD44 MaxPab polyclonal antibody. Western Blot analysis of CD44 expression in HepG2.
Reviews (0)  Have you used this product? Review this product to earn Novus Rewards.

Ask a Scientist

Can't find an answer to your question about CD44? Ask us by using live chat or by submitting your questions below:

 
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies

Related Products

Lysates (3)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
CD44 LysateH00000960-T01HuWB(2)

CD44 LysateNBL1-08952WB(1)

CD44 LysateH00000960-T02WB

Peptides and Proteins
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
CD44 Recombinant ProteinH00000960-P02HuELISA, WB(1)

CD44 Recombinant ProteinH00000960-P01ELISA, WB(1)

CD44 ProteinH00000960-G01HuFunc

CD44 ProteinNBP1-94196Hu

Primary Antibodies (99)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
CD44 Antibody (8E2F3)NBP1-47386Hu, MuELISA, IF, IHC-Fr, IHC-P, WB(7)

CD44 AntibodyNBP1-31488HuICC, IF, IHC-P, WB(6)

CD44 Antibody (IM7)NBP1-41266Ca, Eq, Fe, Hu, MuFACS, ICC, IHC-Fr, IHC-P, IP, WB

CD44 Antibody (EPR1013Y)NB110-55700Hu, Mu(-), Rt(-)FACS, ICC, IHC-P, WB(2)(3)

CD44 AntibodyNBP1-84578HuIF, IHC-P, WB(3)

... and 94 more. See All »
RNAi (5)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
CD44 RNAiH00000960-R10Hu(1)(4)

CD44 RNAiH00000960-R07Hu(1)(4)

CD44 RNAiH00000960-R08Hu(1)(4)

CD44 RNAiH00000960-R06Hu(1)(4)

CD44 RNAiH00000960-R09Hu(1)(4)

Secondary Antibodies
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Mouse IgG Antibody [Biotin]NB720-BMuELISA, IHC-P, WB

Mouse IgG Antibody [HRP]NB720-HMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [Alkaline Phosphatase]NB720-APMuELISA, ICC, IHC-P, WB

Mouse IgG Antibody [FITC]NB720-FMuICC, IHC-P(2)

Mouse IgG AntibodyNB120-7056Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-)ELISA, IHC-P, IP, WB

See All »

Jump to: Novus Explorer, Research Areas

CD44 in Context


Research Areas related to CD44 (9):
Novus Explorer for CD44 gene

Try our bioinformatic tool that shows the relationships between CD44 and other genes, diseases, pathways and post-translational modifications.