Home » CD30/TNFRSF8 » CD30/TNFRSF8 Proteins » Recombinant Human CD30/TNFRSF8 Protein

We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Register on R&D Systems

Recombinant Human CD30/TNFRSF8 Protein

 Submit a Review

Images

 

Product Details

Summary
Product Discontinued
View other related CD30/TNFRSF8 Peptides and Proteins

Order Details


    • Catalog Number
      H00000943-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human CD30/TNFRSF8 Protein Summary

Description
A recombinant protein with a N-terminal GST tagcorresponding to the amino acids 1-113 of Human TNFRSF8 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:QDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPA
Protein/Peptide Type
Partial Recombinant Protein
Gene
TNFRSF8

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CD30/TNFRSF8 Protein

  • CD30 antigen
  • CD30
  • CD30KI-1
  • CD30L receptor
  • cytokine receptor CD30
  • D1S166EKi-1
  • Ki-1 antigen
  • Lymphocyte activation antigen CD30
  • TNFRSF8
  • tumor necrosis factor receptor superfamily member 8
  • tumor necrosis factor receptor superfamily, member 8

Background

TNFRSF8 - tumor necrosis factor receptor superfamily, member 8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
CD3 Antibody (SP7)
NB600-1441
Immunohistochemistry-Frozen CD3 Antibody (SP7)
Immunohistochemistry-Paraffin CD3 Antibody (SP7)
Immunohistochemistry-Paraffin CD3 Antibody (SP7)
(3 Reviews)
(50 Publications)
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, KD
Cytokeratin 20
Antibody (SA35-03)
NBP2-67309
Flow Cytometry Cytokeratin 20 Antibody (SA35-03)
Immunocytochemistry/ Immunofluorescence Cytokeratin 20 Antibody (SA35-03)
Immunohistochemistry-Paraffin Cytokeratin 20 Antibody (SA35-03)
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(850 Publications)
Species: Hu
Applications: BA
CD20 Antibody
(rIGEL/773) - Azide a ...
NBP2-54591
Immunohistochemistry-Paraffin CD20 Antibody (rIGEL/773) - Azide and BSA Free
Immunohistochemistry-Paraffin CD20 Antibody (rIGEL/773) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence CD20 Antibody (rIGEL/773) - Azide and BSA Free
(1 Review)
(1 Publication)
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, PA
CD45 Antibody
[Unconjugated]
AF114
Immunohistochemistry CD45 Antibody [Unconjugated]
Immunocytochemistry CD45 Antibody [Unconjugated]
Immunocytochemistry/ Immunofluorescence CD45 Antibody [Unconjugated]
(1 Review)
(88 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
CD4 Antibody - BSA
Free
NBP1-19371
Immunohistochemistry-Frozen CD4 Antibody - BSA Free
Immunohistochemistry-Paraffin CD4 Antibody - BSA Free
Flow Cytometry CD4 Antibody - BSA Free
(9 Reviews)
(53 Publications)
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
IL-4 [Unconjugated]
6507-IL/CF
Bioactivity IL-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(390 Publications)
Species: Hu
Applications: BA
CD30 Ligand/TNFSF8
Antibody [Unconjugate ...
AF1028
Immunohistochemistry CD30 Ligand/TNFSF8 Antibody [Unconjugated]
Immunohistochemistry CD30 Ligand/TNFSF8 Antibody [Unconjugated]
Flow Cytometry CD30 Ligand/TNFSF8 Antibody [Unconjugated]
(3 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, IHC, WB
CD8 Antibody
(53-6.7) - BSA Free
NBP1-49045
Immunohistochemistry-Paraffin CD8 Antibody (53-6.7) - BSA Free
Immunocytochemistry/ Immunofluorescence CD8 Antibody (53-6.7) - BSA Free
Immunohistochemistry-Frozen CD8 Antibody (53-6.7) - BSA Free
(3 Reviews)
(28 Publications)
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
CD25/IL-2R alpha
[HRP]
DR2A00
N/A CD25/IL-2R alpha [HRP]
N/A CD25/IL-2R alpha [HRP]
(37 Publications)
Species: Hu
Applications: ELISA
MUC1 Antibody
(SM3) - BSA Free
NB120-22711
Immunocytochemistry/ Immunofluorescence MUC1 Antibody (SM3) - BSA Free
Flow Cytometry MUC1 Antibody (SM3) - BSA Free
Immunocytochemistry/ Immunofluorescence MUC1 Antibody (SM3) - BSA Free
(14 Publications)
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P
ISG20 Antibody
(1B2-3C9) - Azide and ...
H00003669-M01
Western Blot ISG20 Antibody (1B2-3C9) - Azide and BSA Free
Western Blot ISG20 Antibody (1B2-3C9) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence ISG20 Antibody (1B2-3C9) - Azide and BSA Free
(1 Review)
(2 Publications)
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
ALK/CD246 Antibody
[Unconjugated]
AF4210
Western Blot ALK/CD246 Antibody [Unconjugated]
Immunohistochemistry ALK/CD246 Antibody [Unconjugated]
Simple Western ALK/CD246 Antibody [Unconjugated]
(1 Review)
Species: Hu
Applications: IHC, Simple Western, WB
IFN-gamma
[Unconjugated]
485-MI
SDS-PAGE IFN-gamma [Unconjugated]
Bioactivity IFN-gamma [Unconjugated]
SEC-MALS IFN-gamma [Unconjugated]
(485 Publications)
Species: Mu
Applications: BA

Publications for CD30/TNFRSF8 Partial Recombinant Protein (H00000943-Q01) (0)

There are no publications for CD30/TNFRSF8 Partial Recombinant Protein (H00000943-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD30/TNFRSF8 Partial Recombinant Protein (H00000943-Q01) (0)

There are no reviews for CD30/TNFRSF8 Partial Recombinant Protein (H00000943-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD30/TNFRSF8 Partial Recombinant Protein (H00000943-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CD30/TNFRSF8 Products

Research Areas for CD30/TNFRSF8 Partial Recombinant Protein (H00000943-Q01)

Find related products by research area.

Blogs on CD30/TNFRSF8.

Check out the latest blog posts on CD30/TNFRSF8.
Unlocking the Potential of Biosimilars in Immuno-Oncology
By Jennifer Jones, M.S.Biosimilar Antibodies: Imitation Meets InnovationIn the ever-evolving medical landscape, a new class of pharmaceuticals is emerging as a game-changer, poised to transform the way we approach...  Read full blog post.

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CD30/TNFRSF8 Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol TNFRSF8