CD30 Antibody (H00000943-M03)
CD30 Antibody (2E2)
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-CD30 antibody, anti-Ki-1 antibody, anti-D1S166E antibody, |
|
|
CD30 Antibody (2E2) Summary: | | Gene: | TNFRSF8 |
|---|
| Purity: | IgG purified |
|---|
| Host: | Mouse |
|---|
| | Specificity: | TNFRSF8 - tumor necrosis factor receptor superfamily, member 8 (2E2) |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional CD30 Products CD30 Antibody (2E2) Details: | Clone: | 2E2 |
|---|
| Isotype: | IgG2b Kappa |
|---|
| Immunogen: | TNFRSF8 (NP_001234, 21 a.a. ~ 134 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
|---|
| Epitope: | QDRPFEDTCHGNPSHYYDKAVRRCCYRCPM GLFPTQQCPQRPTDCRKQCEPDYYLDEADR CTACVTCSRDDLVEKTPCAWNSSRVCECRP GMFCSTSAVNSCARCFFHSVCPA* |
|---|
| Uses: | Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
|---|
| Dilutions: | ELISA,
Western Blot 1:500 |
|---|
| Unit Size: | 0.1 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | In 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is expressed by activated, but not by resting, T and B cells. TRAF2 and TRAF5 can interact with this receptor, and mediate the signal transduction that leads to the activation of NF-kappaB. This receptor is a positive regulator of apoptosis, and also has been shown to limit the proliferative potential of autoreactive CD8 effector T cells and protect the body against autoimmunity. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq]
|
Images (1) Reviews (0) Related Products (45) Exploring CD30
|
Jump to: Images, Ask a Question
|
Working with CD30
CD30 Antibody (2E2) Images (1) Detection limit for recombinant GST tagged TNFRSF8 is approximately 0.3ng/ml as a capture antibody. |
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about CD30? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsLysates (1)Peptides and ProteinsPrimary Antibodies (40)RNAi (2)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
