We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human CD3 zeta Protein

Images

 

Product Details

Summary
Product Discontinued
View other related CD3 zeta Peptides and Proteins

Order Details


    • Catalog Number
      H00000919-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human CD3 zeta Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-164 of Human CD3Z full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MKWKALFTAAILQAQLPITEAQSFGLLDPKLCYLLDGILFIYGVILTALFLRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
CD247
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
43.78 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CD3 zeta Protein

  • CD247 antigen
  • CD247 antigen, zeta subunit
  • CD247 molecule
  • CD247
  • CD3 zeta
  • CD3H
  • CD3Q
  • CD3z antigen, zeta polypeptide (TiT3 complex)
  • CD3Z
  • CD3ZT-cell receptor T3 zeta chain
  • IMD25
  • T3Z
  • T-cell antigen receptor complex, zeta subunit of CD3
  • T-cell surface glycoprotein CD3 zeta chain
  • TCR Zeta Chain
  • TCRZCD3-ZETA

Background

CD3 (Cluster of Differentiation 3) is a complex of proteins that associates directly with the T cell antigen receptor (TCR). Antigen binding to the TCR leads to IL-2 secretion via activation of a tyrosine phosphorylation pathway and a phospholipase C (PLC) pathway, in turn activating protein kinase C. CD3 is composed of five invariant polypeptide chains that associate to form three dimers. The five invariant chains of CD3 are labeled gamma, delta, epsilon, zeta, and eta. The zeta chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Loss of the zeta chain results in the synthesis of unstable TCRs. A decrease of CD3 zeta has been described in T cells from patients with cancer, lupus and chronic infectious diseases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1441
Species: Ca, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, KD
202-IL
Species: Hu
Applications: BA
AF3709
Species: Hu
Applications: IHC, Simple Western, WB
MAB7500
Species: Hu
Applications: ICC, WB
NBP1-49045
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
485-MI
Species: Mu
Applications: BA
NB500-517
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
MAB342
Species: Hu
Applications: AgAct, ICC, WB
4325-FC
Species: Hu
Applications: Bind
NBP2-32636
Species: Hu
Applications: IHC,  IHC-P, Simple Western, WB
1597-FC/CF
Species: Hu
Applications: Bind
DFL00B
Species: Hu
Applications: ELISA
NBP1-84084
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB139
Species: Hu
Applications: CostimT, CyTOF-ready, Flow, Neut, WB
NBP2-46218
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
H00000919-P01
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for CD3 zeta Recombinant Protein (H00000919-P01) (0)

There are no publications for CD3 zeta Recombinant Protein (H00000919-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD3 zeta Recombinant Protein (H00000919-P01) (0)

There are no reviews for CD3 zeta Recombinant Protein (H00000919-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD3 zeta Recombinant Protein (H00000919-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CD3 zeta Products

Research Areas for CD3 zeta Recombinant Protein (H00000919-P01)

Find related products by research area.

Blogs on CD3 zeta

There are no specific blogs for CD3 zeta, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CD3 zeta Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CD247