CD1b Antibody 0.1 ml

Click image to view larger
Western Blot: CD1b Antibody [NBP1-86559] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY419761)
Immunohistochemistry-Paraffin: CD1b Antibody [NBP1-86559] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.
Download Datasheet
See All Related

Ordering Information: NBP1-86559

  • Catalog Number
    NBP1-86559
  • Displayed Format
    Unconjugated
  • Size(s)
    0.1 ml
  • Availability
  • Price
    Shipping
  

CD1b Antibody Summary

Species Human
Tested Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Gene
CD1B
Purity
Immunogen affinity purified
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Guarantee Plus
All of our products are backed by our 100% guarantee to work for stated and predicted species and applications.
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

CD1b Antibody Details

Isotype
IgG
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IHGWDSDSGTAIFLKPWSKGNFSDKEVAELEEIFRVYIFGFAREVQDFAGDFQMKYPFEIQGIAGCELHSGGAIVSFLRGALGGLDFLSVKNASCVPSPEGGSRAQKFCALIIQYQGIMETVRILLYETCPRYLLGVLNAGKAD

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For HIER pH6 retrieval is recommended.
Control Peptide
CD1b Protein (NBP1-86559PEP)

Contact Information

Product PDFs

Frequently Purchased Together

Reviews

Earn rewards points by submitting your review for CD1b Antibody (NBP1-86559). Be the first to review this product and earn double rewards points!

Publications

Earn rewards if you have published using CD1b Antibody (NBP1-86559).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Unit Size
0.1 ml
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Preservative
0.02% Sodium Azide
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

Gene Symbol CD1B
Entrez

Alternate Names for CD1b Antibody

  • CD1
  • CD1A
  • CD1b antigen
  • CD1B antigen, b polypeptide
  • CD1b molecule
  • CD1b
  • cortical thymocyte antigen CD1B
  • differentiation antigen CD1-alpha-3
  • MGC125990
  • MGC125991
  • R1
  • T-cell surface glycoprotein CD1b
Show More

Related Products by Gene


Reviews for CD1b Antibody (NBP1-86559) (0)

There are no reviews for CD1b Antibody (NBP1-86559).
By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image
Have you used CD1b Antibody (NBP1-86559)? Submit your review and earn rewards points which can be used for merchandise & discounts.
Points can be redeemed for discounts and gift cards:
$50/€35/£30/$50CAN Amazon Gift Card1000 Points
Items ships for Free, please disregard any shipping charges.
$50/€35/£30/$50CAN Off Purchase (credited after checkout)1000 Points
Discount is removed from total when the order is processed. The discount will not appear in your shopping cart on check out.

Publications for CD1b Antibody (NBP1-86559) (0)

There are no publications for CD1b Antibody (NBP1-86559).
By submitting a publication earn 200 points for your submission points towards our Rewards Program.
Have you published using CD1b Antibody (NBP1-86559)? Earn rewards points which can be used for merchandise & discounts.
Points can be redeemed for discounts and gift cards:
$50/€35/£30/$50CAN Amazon Gift Card1000 Points
Items ships for Free, please disregard any shipping charges.
$50/€35/£30/$50CAN Off Purchase (credited after checkout)1000 Points
Discount is removed from total when the order is processed. The discount will not appear in your shopping cart on check out.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

Ask a Scientist

Submit your question on below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
CAPTCHA
This question is for testing whether or not you are a human visitor and to prevent automated spam submissions.

FAQs for CD1b (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Viewed This Item Also Viewed...

NBP2-31691
Western Blot: CD1e Antibody [NBP2-31691] - CD1E Antibody [NBP2-31691] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spImmunohistochemistry: CD1e Antibody [NBP2-31691] - Liver cancerImmunohistochemistry: CD1e Antibody [NBP2-31691] - Staining of human lymph node shows moderate cytoplasmic positivity in subset of non-germinal center cells.

Rabbit Polyclonal
Species Human
Applications WB, IHC, IHC-P

H00006241-M01
Western Blot: RRM2 Antibody (1E1) [H00006241-M01] - RRM2 monoclonal antibody (M01), clone 1E1. Analysis of RRM2 expression in HepG2.Immunocytochemistry/Immunofluorescence: RRM2 Antibody (1E1) [H00006241-M01] - Analysis of monoclonal antibody to RRM2 on HeLa cell. Antibody concentration 10 ug/ml.Immunohistochemistry-Paraffin: RRM2 Antibody (1E1) [H00006241-M01] - Analysis of monoclonal antibody to RRM2 on formalin-fixed paraffin-embedded human stomach. Antibody concentration 1.5 ug/ml.

Mouse Monoclonal
Species Human
Applications WB, ELISA, ICC/IF...MORE

7 Publications
NBP1-76775
Western Blot: CD82/Kai-1 Antibody [NBP1-76775] - A549 cell lysate with CD82 antibody at (A) 0.5 and (B) 1 ug/ml.Immunocytochemistry/Immunofluorescence: CD82/Kai-1 Antibody [NBP1-76775] - Human Colon cells.Immunohistochemistry-Paraffin: CD82/Kai-1 Antibody [NBP1-76775] - Human colon tissue section.

Rabbit Polyclonal
Species Human, Mouse, Rat
Applications WB, ELISA, ICC/IF...MORE

NBP1-43461
Flow Cytometry: CD1d Antibody (1B1) [NBP1-43461] - Analysis using the Biotin conjugate of NBP1-43461. Staining of BALB/c splenocytes with Anti-Human/Mouse CD45R (B220) FITC and 0.5 ug of Rat IgG2b kappa Isotype Control Biotin (left) or 0.5 ug of Anti-Mouse CD1d Biotin (right) followed by Streptavidin PE.Flow Cytometry: CD1d Antibody (1B1) [NBP1-43461] - Staining of BALB/c splenocytes with 1.0 ug of Rat IgG2b Isotype Control Purified  (open histogram) or 1.0 ug of Anti-Mouse CD1d Purified (filled histogram) followed by Anti-Rat IgG FITC. Total viable cells were used for analysis.

Rat Monoclonal
Species Mouse
Applications Flow, IHC, IP

1 Publication
NBP1-84550
Western Blot: HLA DQA1 Antibody [NBP1-84550] - Lane 1: Marker [KDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human cell line Daudi.Immunocytochemistry/Immunofluorescence: HLA DQA1 Antibody [NBP1-84550] - Staining of human cell line U-251MG shows positivity in cytoplasm.Immunohistochemistry-Paraffin: HLA DQA1 Antibody [NBP1-84550] - Staining of human tonsil shows strong cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction centra.

Rabbit Polyclonal
Species Human
Applications WB, ICC/IF, IHC...MORE

NB100-524
Western Blot: NOD2 Antibody (2D9) [NB100-524] - Western Blot Image of anti-NOD2 (2D9) Whole cell protein from THP-1 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2 ug/ml anti-NOD2 in 1% milk, and detected with an anti-mouse HRP secondary antibody using chemiluminescence.Immunocytochemistry/Immunofluorescence: NOD2 Antibody (2D9) [NB100-524] - A431 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-NOD2 (2D9) NB100-524 at a 1:200 dilution overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was counterstained with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.Western Blot: NOD2 Antibody (2D9) [NB100-524] - Detection of NOD2 in 20ug of NOD2 transfected 293T cell lysate using NB 100-524. ECL detection in 10 seconds.

Mouse Monoclonal
Species Human, Mouse
Applications WB, ICC/IF, IHC...MORE

     1 Review

12 Publications
NBP1-19371
Western Blot: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in the following cell lysates: Lane 1) human spleen 2) human tonsil 3) human placenta 4) human kidney 5) human liver 6) mouse spleen 7) mouse placenta 8) rat placenta.Immunocytochemistry/Immunofluorescence: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in Jurkat cells with Dylight 488 (green). Nuclei were counterstained with DAPI (blue).Immunohistochemistry-Paraffin: CD4 Antibody [NBP1-19371] - IHC analysis of a formalin fixed paraffin embedded tissue section of mouse spleen using CD4 antibody at 1:300 dilution with HRP-DAB detection and hematoxylin counterstaining. The antibody generated a strong signal in the membranes of a subset of cells in the spleen section and the staining showed punctate appearance in some cells.

Rabbit Polyclonal
Species Human, Mouse, Rat...MORE
Applications WB, Simple Western, ICC/IF...MORE

     5 Reviews

7 Publications
NBP1-49045
Immunocytochemistry: CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of immersion fixed splenocytes. Primary antibody was used at a dilution of 10 ug/ml and incubated for 3 hours at room temperature.Immunohistochemistry-Frozen: CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of CD8+ T cells in allogeneic skin grafted onto a mouse.Flow Cytometry: CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of lymph nodes by multiple staining.

Rat Monoclonal
Species Mouse, Rat
Applications Flow, ICC/IF, IHC...MORE

     1 Review

5 Publications
NBP2-37476
Western Blot: Doublecortin Antibody (2G5) [NBP2-37476] - Western blot analysis using DCX mouse mAb against Mouse heart (1) lysate.Immunocytochemistry/Immunofluorescence: Doublecortin Antibody (2G5) [NBP2-37476] - Immunofluorescence analysis of HepG2 cells using DCX mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye.Immunohistochemistry: Doublecortin Antibody (2G5) [NBP2-37476] - Immunohistochemical analysis of paraffin-embedded brain tissue tissues using DCX mouse mAb with DAB staining.

Mouse Monoclonal
Species Human, Mouse
Applications WB, ELISA, Flow...MORE

NB120-6405
Immunocytochemistry/Immunofluorescence: MHC Class I Antibody (OX18) [NB120-6405] - PC-12 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-MHC Class I (OX18) NB120-6405 at a 1:100 dilution overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.Flow Cytometry: MHC Class I Antibody (OX18) [NB120-6405] - Analysis using the FITC conjugate of NB120-6405. Staining of rat spleen cells with mouse anti-rat RT1-A (OX18).Flow (Intracellular): MHC Class I Antibody (OX18) [NB120-6405] - PC-12 cells were stained with MHC Class I NB120-6405 (blue) and a matched isotype control NBP2-27287 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-mouse secondary antibody.

Mouse Monoclonal
Species Rat
Applications B/N, ELISA, Flow...MORE

29 Publications
NBP2-24867
Flow Cytometry: CD3 Antibody (OKT3) - Azide Free [NBP2-24867] - Analysis of CD3+ hPMBCs using the APC conjugate of this antibody. A cell surface stain was performed on CD3+ hPBMCs with V alpha 24 J alpha 18 TCR antibody (6B11) NBP2-00267PE (top image) and a matched isotype control NBP2-27287 (bottom image). Cells were incubated in an antibody dilution of 1 ug/mL for 20 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin. A co-stain was also performed using CD3 antibody NBP2-24867APC.Flow Cytometry: CD3 Antibody (OKT3) - Azide Free [NBP2-24867] - Surface staining of human PBMC with CD3 antibody (red) and isotype control (green) at 0.2 ug/10^6 cells.Flow Cytometry: CD3 Antibody (OKT3) - Azide Free [NBP2-24867] - Surface staining of human PBMC with CD3 antibody (red) grown in serum-free media and isotype control (green) at 0.25 ug/10^6 cells.

Mouse Monoclonal
Species Human
Applications Flow, Func, In vitro...MORE

6 Publications

Bioinformatics Tool for CD1b

Discover related pathways, diseases and genes to CD1b. Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Bioinformatics Tool
Vizit™, under license from BioVista Inc.

Research Areas for CD1b

Find related products by research area.

Blogs on CD1b

There are no specific blogs for CD1b, but you can read our latest blog posts.