CD1b Antibody 0.1 ml

Click image to view larger
Western Blot: CD1b Antibody [NBP1-86559] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Negative control (vector only transfected HEK293T lysate)<br/>Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY419761)
Immunohistochemistry-Paraffin: CD1b Antibody [NBP1-86559] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.
Download Datasheet
See All Related

Ordering Information: NBP1-86559

  • Catalog Number
    NBP1-86559
  • Displayed Format
    Unconjugated
  • Size(s)
    0.1 ml
  • Availability
  • Price
    Shipping
  

CD1b Antibody Summary

Species Human
Tested Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Gene
CD1B
Purity
Immunogen affinity purified
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Guarantee Plus
All of our products are backed by our 100% guarantee to work for stated and predicted species and applications.
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

CD1b Antibody Details

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IHGWDSDSGTAIFLKPWSKGNFSDKEVAELEEIFRVYIFGFAREVQDFAGDFQMKYPFEIQGIAGCELHSGGAIVSFLRGALGGLDFLSVKNASCVPSPEGGSRAQKFCALIIQYQGIMETVRILLYETCPRYLLGVLNAGKAD

Species Reactivity

Human

Applications/Dilutions

Dilutions
  • Western Blot 1:100-500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For HIER pH6 retrieval is recommended.

Contact Information

Product PDFs

Frequently Purchased Together

Reviews

Earn rewards points by submitting your review for CD1b Antibody (NBP1-86559). Be the first to review this product and earn double rewards points!

Publications

Earn rewards if you have published using CD1b Antibody (NBP1-86559).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Unit Size
0.1 ml
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Preservative
0.02% Sodium Azide
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

Gene Symbol CD1B

Alternate Names for CD1b Antibody

  • CD1
  • CD1A
  • CD1b antigen
  • CD1B antigen, b polypeptide
  • CD1b molecule
  • cortical thymocyte antigen CD1B
  • differentiation antigen CD1-alpha-3
  • MGC125990
  • MGC125991
  • R1
  • T-cell surface glycoprotein CD1b
Show More

Related Products by Gene


Reviews for CD1b Antibody (NBP1-86559) (0)

There are no reviews for CD1b Antibody (NBP1-86559).
By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image
Have you used CD1b Antibody (NBP1-86559)? Submit your review and earn rewards points which can be used for merchandise & discounts.
Points can be redeemed for discounts and gift cards:
$50/€35/£30/$50CAN Amazon Gift Card1000 Points
Items ships for Free, please disregard any shipping charges.
$50/€35/£30/$50CAN Off Purchase (credited after checkout)1000 Points
Discount is removed from total when the order is processed. The discount will not appear in your shopping cart on check out.

Publications for CD1b Antibody (NBP1-86559) (0)

There are no publications for CD1b Antibody (NBP1-86559).
By submitting a publication earn 200 points for your submission points towards our Rewards Program.
Have you published using CD1b Antibody (NBP1-86559)? Earn rewards points which can be used for merchandise & discounts.
Points can be redeemed for discounts and gift cards:
$50/€35/£30/$50CAN Amazon Gift Card1000 Points
Items ships for Free, please disregard any shipping charges.
$50/€35/£30/$50CAN Off Purchase (credited after checkout)1000 Points
Discount is removed from total when the order is processed. The discount will not appear in your shopping cart on check out.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

Ask a Scientist

Submit your question on below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
CAPTCHA
This question is for testing whether or not you are a human visitor and to prevent automated spam submissions.

FAQs for CD1b (2)

  1. In the immunohistochemistry paraffin section protocol....the PBS buffer....should it be at certain pH?
    • For IHC application, different labs cites the pH of PBS buffer in the range of 7.1 - 7.6 but most commonly used pH is pH 7.4 (this is what we use in our lab). You may use this PBS (pH 7.4) for making permeablization buffer, antibody diluent buffers and for making wash buffer. For more on the protocol that we use in our lab and for IHC-P troubleshooting suggestions, you may visit: IHC-P Protocol and IHC-P Troubleshooting.
  2. I was wondering what does Format 7C mean as far as anitbodies go?
    • 7C is a fluorophore - it is useful for FLOW. The details of the fluor are (A=425, E=500)

Customers Who Viewed This Item Also Viewed...

NBP2-31691
Western Blot: CD1E Antibody [NBP2-31691] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10&lt;br/&gt;Lane 2: Human cell line RT-4&lt;br/&gt;Lane 3: Human cell line U-251MG spImmunohistochemistry: CD1E Antibody [NBP2-31691] - liver cancerWestern Blot: CD1E Antibody [NBP2-31691] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10&lt;br/&gt;Lane 2: Human cell line RT-4&lt;br/&gt;Lane 3: Human cell line U-251MG sp

Rabbit Polyclonal
Species Human
Applications WB, IHC

H00006241-M01
Western Blot: RRM2 Antibody (1E1) [H00006241-M01] - Western Blot analysis of RRM2 expression in HeLa NE ( Cat # L013V3 ).Immunocytochemistry/Immunofluorescence: RRM2 Antibody (1E1) [H00006241-M01] - Immunofluorescence of monoclonal antibody to RRM2 on HeLa cell . [antibody concentration 10 ug/ml]Immunohistochemistry-Paraffin: RRM2 Antibody (1E1) [H00006241-M01] - Immunoperoxidase of monoclonal antibody to RRM2 ( Cat # H00006241-M01 ) on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1.5 ug/ml]

Mouse Monoclonal
Species Human
Applications WB, ELISA, ICC/IF...MORE

4 Publications
NBP2-21792

Mouse Monoclonal
Species Human
Applications WB, FLOW, Func...MORE

NBP1-43461
Flow Cytometry: CD1d Antibody (1B1) [NBP1-43461] - Staining of BALB/c splenocytes with 1.0 ug of Rat IgG2b Isotype Control Purified  (open histogram) or 1.0 ug of Anti-Mouse CD1d Purified (filled histogram) followed by Anti-Rat IgG FITC . Total viable cells were used for analysis.

Rat Monoclonal
Species Mouse
Applications FLOW, Func, IHC...MORE

1 Publication
NBP2-31143
Western Blot: CTLA4 Antibody (37B3D8.2F2) [NBP2-31143] - WB analysis of CTLA-4 protein on (A) mouse Kidney lysate (B) human Kidney lysate and on &amp;#169; partial recombinant protein using CTLA-4 monoclonal antibody at a concentration of 2 ug/ml.

Mouse Monoclonal
Species Human, Mouse
Applications WB

NB100-65423
Flow Cytometry: HLA DQ/DR Antibody (49.1) [NB100-65423] - Staining of sheep peripheral blood lymphocytes with MOUSE ANTI OVINE MHC CLASS II DQ/DR (POLYMORPHIC).

Mouse Monoclonal
Species Human, Bovine, Goat...MORE
Applications FLOW, IHC, IHC-Fr...MORE

NB100-524
Western Blot: NOD2 Antibody (2D9) [NB100-524] - Detection of endogenous NOD2 in 50ug of HT29 cell lysate using NB 100-524. ECL detection in 15 minutes.Immunocytochemistry/Immunofluorescence: NOD2 Antibody (2D9) [NB100-524] - analysis of PFA fixed mouse sciatic nerve section using anti-NOD2 antibody. Image from verified customer review. Western Blot: NOD2 Antibody (2D9) [NB100-524] - Detection of NOD2 in 20ug of NOD2 transfected 293T cell lysate using NB 100-524. ECL detection in 10 seconds.

Mouse Monoclonal
Species Human, Mouse
Applications WB, ICC/IF, IHC...MORE

     1 Review

12 Publications
NBP1-19532
Immunocytochemistry/Immunofluorescence: TNF alpha Antibody [NBP1-19532] - TNF alpha antibody was tested in A431 cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red). Immunohistochemistry-Paraffin: TNF alpha Antibody [NBP1-19532] - Immunohistochemical staining of TNF alpha in mouse intestine.

Rabbit Polyclonal
Species Human, Mouse, Rat
Applications WB, ICC/IF, IHC...MORE

     1 Review

4 Publications
NBP2-34896


Species Human
Applications Func, PAGE

NBP2-25199
Flow Cytometry: CD4 Antibody (RPA-T4) [NBP2-25199] - Cell surface flow analysis of CD4 in human PBMC using this antibody at 0.25 ug/10^6 cells. Cells were stained with primary antibody followed by a PE-conjugated goat anti-mouse secondary antibody this antibody . Green represents isotype control this antibody ; red represents anti-CD4 antibody. Cells in the lymphocyte gate were used for analysis.

Mouse Monoclonal
Species Human
Applications B/N, FLOW, IHC...MORE

     1 Review

NBP2-25195
Flow Cytometry: CD8 alpha Antibody (RPA-T8) [NBP2-25195] - Cell surface flow analysis of CD8 in human PBMC using this antibody at 0.25 ug/10^6 cells. Cells were stained with primary antibody followed by a PE-conjugated goat anti-mouse secondary antibody this antibody . Green represents isotype control this antibody ; red represents anti-CD8 this antibody.

Mouse Monoclonal
Species Human
Applications FLOW

NBP1-92684
Western Blot: Doublecortin Antibody (3E1) [NBP1-92684] - Western blot of crude rat brain extract from a postnatal 3 day animal stained with NBP1-92684. Two bands at ~45kDa and ~35kDa show that NBP1-92684 binds to an epitope in the region of Doublecortin shared by Lis-A, and Lis-B, Lis-C and Lis-D, the C terminal 360 amino acids of Lis-A.Immunocytochemistry/Immunofluorescence: Doublecortin Antibody (3E1) [NBP1-92684] - Rat brain neural cultures stained with NBP1-92684 (green), a chicken polyclonal antibody to GFAP (NB300-213, red) and DNA (blue). The NBP1-92684 antibody reveals strong cytoplasmic staining in a population of small developing neurons. These cells are often found in small clumps as in these cultures, as in this example. Note that they are not positive for MAP2, which is characteristic of more mature neurons, and that the mature neuron shown is negative for NBP1-92684. This Doublecortin antibody is therefore an excellent marker of developing neuronal cells.

Mouse Monoclonal
Species Human, Mouse, Rat...MORE
Applications WB, ICC/IF

NB100-78191
Sandwich ELISA: Interferon gamma Antibody (R4-6A2) [NB100-78191] - Detection   [NB100-78191]

Rat Monoclonal
Species Mouse
Applications ELISA, IHC, IHC-Fr

6 Publications
NB110-57201
Western Blot: MHC Class I Antibody (EP1395Y) [NB110-57201] Raji cell lysate using a 1:10,000 dilution.Immunocytochemistry/Immunofluorescence: MHC Class I Antibody (EP1395Y) [NB110-57201] -  stained MCF7 cells.Immunohistochemistry-Paraffin: MHC Class I Antibody (EP1395Y) [NB110-57201] - staining HLA A in Human tonsil tissue sections.

Rabbit Monoclonal
Species Human, Mouse (Negative), Rat (Negative)
Applications WB, FLOW, ICC/IF...MORE

1 Publication
NBP2-24867
Flow Cytometry: CD3 Antibody (OKT3) [Azide Free] [NBP2-24867] - Surface staining of human PBMC with CD3 antibody (red) grown in serum-free media and isotype control (green) at 0.25 ug/10^6 cells.Flow Cytometry: CD3 Antibody (OKT3) [Azide Free] [NBP2-24867] - Surface staining of human PBMC with CD3 antibody (red) and isotype control (green) at 0.2 ug/10^6 cells.

Mouse Monoclonal
Species Human
Applications FLOW, Func

1 Publication
NBP2-27573
Western Blot: IL10 Antibody (JES3-9D7) [NBP2-27573] - ecombinant protein probed with RAT ANTI HUMAN INTERLEUKIN-10 followed by F(ab

Rat Monoclonal
Species Human
Applications WB, IHC, PEP-ELISA

6 Publications
NBP2-25173

Mouse Monoclonal
Species Human
Applications FLOW, ICC/IF, IHC...MORE

NB600-1131
Western Blot: IL6 Antibody [NB600-1131] - Shows detection of a band ~21 kDa in size corresponding to anti-IL6 antibody. Molecular weight markers are also shown (MW). After transfer, the membrane was blocked for 30 minutes with 1% BSA-TBST. Detection occurred using peroxidase conjugated anti-Rabbit IgG secondary antibody diluted 1:40,000 in blocking buffer for 30 min at RT followed by reaction with FemtoMax &amp;#8482; chemiluminescent substrate.Immunocytochemistry/Immunofluorescence: IL6 Antibody [NB600-1131] - IL-6 antibody was tested in Raw264.7 cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).Immunohistochemistry-Paraffin: IL6 Antibody [NB600-1131] - IHC staining of IL6 in human bladder cancer using DAB with hematoxylin counterstain.

Rabbit Polyclonal
Species Human, Mouse, Rat
Applications WB, ELISA, ICC/IF...MORE

6 Publications
NBP2-34893


Species Human
Applications Func, PAGE

Bioinformatics Tool for CD1b

Discover related pathways, diseases and genes to CD1b. Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Bioinformatics Tool

Research Areas for CD1b

Find related products by research area.

Blogs on CD1b

There are no specific blogs for CD1b, but you can read our latest blog posts.