CD1b Antibody 0.1 ml

Click image to view larger
Western Blot: CD1b Antibody [NBP1-86559] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Negative control (vector only transfected HEK293T lysate)Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY419761)
Immunohistochemistry-Paraffin: CD1b Antibody [NBP1-86559] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.
Download Datasheet
See All Related

Ordering Information: NBP1-86559

  • Catalog Number
    NBP1-86559
  • Displayed Format
    Unconjugated
  • Size(s)
    0.1 ml
  • Availability
  • Price
    Shipping
  

CD1b Antibody Summary

Species Human
Tested Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Gene
CD1B
Purity
Immunogen affinity purified
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Guarantee Plus
All of our products are backed by our 100% guarantee to work for stated and predicted species and applications.
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

CD1b Antibody Details

Isotype
IgG
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IHGWDSDSGTAIFLKPWSKGNFSDKEVAELEEIFRVYIFGFAREVQDFAGDFQMKYPFEIQGIAGCELHSGGAIVSFLRGALGGLDFLSVKNASCVPSPEGGSRAQKFCALIIQYQGIMETVRILLYETCPRYLLGVLNAGKAD

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For HIER pH6 retrieval is recommended.
Control Peptide
CD1b Protein (NBP1-86559PEP)

Contact Information

Product PDFs

Frequently Purchased Together

Reviews

Earn rewards points by submitting your review for CD1b Antibody (NBP1-86559). Be the first to review this product and earn double rewards points!

Publications

Earn rewards if you have published using CD1b Antibody (NBP1-86559).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Unit Size
0.1 ml
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Preservative
0.02% Sodium Azide
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

Gene Symbol CD1B
Entrez

Alternate Names for CD1b Antibody

  • CD1
  • CD1A
  • CD1b antigen
  • CD1B antigen, b polypeptide
  • CD1b molecule
  • CD1b
  • cortical thymocyte antigen CD1B
  • differentiation antigen CD1-alpha-3
  • MGC125990
  • MGC125991
  • R1
  • T-cell surface glycoprotein CD1b
Show More

Related Products by Gene


Reviews for CD1b Antibody (NBP1-86559) (0)

There are no reviews for CD1b Antibody (NBP1-86559).
By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image
Have you used CD1b Antibody (NBP1-86559)? Submit your review and earn rewards points which can be used for merchandise & discounts.
Points can be redeemed for discounts and gift cards:
$50/€35/£30/$50CAN Amazon Gift Card1000 Points
Items ships for Free, please disregard any shipping charges.
$50/€35/£30/$50CAN Off Purchase (credited after checkout)1000 Points
Discount is removed from total when the order is processed. The discount will not appear in your shopping cart on check out.

Publications for CD1b Antibody (NBP1-86559) (0)

There are no publications for CD1b Antibody (NBP1-86559).
By submitting a publication earn 200 points for your submission points towards our Rewards Program.
Have you published using CD1b Antibody (NBP1-86559)? Earn rewards points which can be used for merchandise & discounts.
Points can be redeemed for discounts and gift cards:
$50/€35/£30/$50CAN Amazon Gift Card1000 Points
Items ships for Free, please disregard any shipping charges.
$50/€35/£30/$50CAN Off Purchase (credited after checkout)1000 Points
Discount is removed from total when the order is processed. The discount will not appear in your shopping cart on check out.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

Ask a Scientist

Submit your question on below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
CAPTCHA
This question is for testing whether or not you are a human visitor and to prevent automated spam submissions.

FAQs for CD1b (2)

  1. In the immunohistochemistry paraffin section protocol....the PBS buffer....should it be at certain pH?
    • For IHC application, different labs cites the pH of PBS buffer in the range of 7.1 - 7.6 but most commonly used pH is pH 7.4 (this is what we use in our lab). You may use this PBS (pH 7.4) for making permeablization buffer, antibody diluent buffers and for making wash buffer. For more on the protocol that we use in our lab and for IHC-P troubleshooting suggestions, you may visit: IHC-P Protocol and IHC-P Troubleshooting.
  2. I was wondering what does Format 7C mean as far as anitbodies go?
    • 7C is a fluorophore - it is useful for FLOW. The details of the fluor are (A=425, E=500)

Customers Who Viewed This Item Also Viewed...

NBP2-31691
Western Blot: CD1e Antibody [NBP2-31691] - CD1E Antibody [NBP2-31691] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spImmunohistochemistry: CD1e Antibody [NBP2-31691] - Liver cancerImmunohistochemistry: CD1e Antibody [NBP2-31691] - Staining of human lymph node shows moderate cytoplasmic positivity in subset of non-germinal center cells.

Rabbit Polyclonal
Species Human
Applications WB, IHC, IHC-P

H00006241-M01
Western Blot: RRM2 Antibody (1E1) [H00006241-M01] - RRM2 monoclonal antibody (M01), clone 1E1. Analysis of RRM2 expression in HepG2.Immunocytochemistry/Immunofluorescence: RRM2 Antibody (1E1) [H00006241-M01] - Analysis of monoclonal antibody to RRM2 on HeLa cell. Antibody concentration 10 ug/ml.Immunohistochemistry-Paraffin: RRM2 Antibody (1E1) [H00006241-M01] - Analysis of monoclonal antibody to RRM2 on formalin-fixed paraffin-embedded human stomach. Antibody concentration 1.5 ug/ml.

Mouse Monoclonal
Species Human
Applications WB, ELISA, ICC/IF...MORE

7 Publications
NBP1-76775
Western Blot: CD82/Kai-1 Antibody [NBP1-76775] - A549 cell lysate with CD82 antibody at (A) 0.5 and (B) 1 ug/ml.Immunocytochemistry/Immunofluorescence: CD82/Kai-1 Antibody [NBP1-76775] - Human Colon cells.Immunohistochemistry-Paraffin: CD82/Kai-1 Antibody [NBP1-76775] - Human colon tissue section.

Rabbit Polyclonal
Species Human, Mouse, Rat
Applications WB, ELISA, ICC/IF...MORE

NBP1-43461
Flow Cytometry: CD1d Antibody (1B1) [NBP1-43461] - Analysis using the Biotin conjugate of NBP1-43461. Staining of BALB/c splenocytes with Anti-Human/Mouse CD45R (B220) FITC and 0.5 ug of Rat IgG2b kappa Isotype Control Biotin (left) or 0.5 ug of Anti-Mouse CD1d Biotin (right) followed by Streptavidin PE.Flow Cytometry: CD1d Antibody (1B1) [NBP1-43461] - Staining of BALB/c splenocytes with 1.0 ug of Rat IgG2b Isotype Control Purified  (open histogram) or 1.0 ug of Anti-Mouse CD1d Purified (filled histogram) followed by Anti-Rat IgG FITC. Total viable cells were used for analysis.

Rat Monoclonal
Species Mouse
Applications Flow, IHC, IP

1 Publication
325-CT/CF
Recombinant Human CTLA-4 Fc Chimera (Catalog # 325-CT/CF) inhibits IL-2 secretion by stimulated Jurkat human acute T cell leukemia cells. The ED50 for this effect is typically 0.1-0.4 μg/mL when stimulated with 1 μg/mL Recombinant Human B7-1 Fc Chimera (Catalog # 140-B1) in the presence of PHA.1 μg/lane of Recombinant Human CTLA-4 Fc Chimera was resolved with SDS-PAGE under reducing (R) and non-reducing (NR) conditions and visualized by silver staining, showing single bands at 51 kDa and 94 kDa, respectively.


Species Human
Applications BA

6 Publications
NBP1-84550
Western Blot: HLA DQA1 Antibody [NBP1-84550] - Lane 1: Marker [KDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human cell line Daudi.Immunocytochemistry/Immunofluorescence: HLA DQA1 Antibody [NBP1-84550] - Staining of human cell line U-251MG shows positivity in cytoplasm.Immunohistochemistry-Paraffin: HLA DQA1 Antibody [NBP1-84550] - Staining of human tonsil shows strong cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction centra.

Rabbit Polyclonal
Species Human
Applications WB, ICC/IF, IHC...MORE

NB100-524
Western Blot: NOD2 Antibody (2D9) [NB100-524] - Western Blot Image of anti-NOD2 (2D9) Whole cell protein from THP-1 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2 ug/ml anti-NOD2 in 1% milk, and detected with an anti-mouse HRP secondary antibody using chemiluminescence.Immunocytochemistry/Immunofluorescence: NOD2 Antibody (2D9) [NB100-524] - A431 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-NOD2 (2D9) NB100-524 at a 1:200 dilution overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was counterstained with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.Western Blot: NOD2 Antibody (2D9) [NB100-524] - Detection of NOD2 in 20ug of NOD2 transfected 293T cell lysate using NB 100-524. ECL detection in 10 seconds.

Mouse Monoclonal
Species Human, Mouse
Applications WB, ICC/IF, IHC...MORE

     1 Review

12 Publications
210-TA/CF
Recombinant Human TNF-alpha  (Catalog # 210‑TA/CF) induces cytotoxicity in the L-929 mouse fibroblast cell line in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is typically 25‑100 pg/mL.1 µg/lane of Recombinant Human TNF-alpha  was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.


Species Human
Applications BA

274 Publications
204-IL/CF
1 μg/lane of Recombinant Human IL-4 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 14 kDa.Recombinant Human IL-4 (Catalog # 204‑IL/CF) stimulates cell proliferation of the TF-1 human erythroleukemic cell line. The ED50 for this effect is typically 0.05‑02 ng/mL.


Species Human
Applications BA

162 Publications
NBP2-25199
Flow Cytometry: CD4 Antibody (RPA-T4) [NBP2-25199] - Cell surface flow analysis of CD4 in human PBMC using this antibody at 0.25 ug/10^6 cells. Cells were stained with primary antibody followed by a PE-conjugated goat anti-mouse secondary antibody this antibody. Green represents isotype control this antibody ; red represents anti-CD4 antibody. Cells in the lymphocyte gate were used for analysis.

Mouse Monoclonal
Species Human
Applications B/N, Flow, IHC...MORE

     1 Review

11 Publications
NBP1-49045
Immunocytochemistry: CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of immersion fixed splenocytes. Primary antibody was used at a dilution of 10 ug/ml and incubated for 3 hours at room temperature.Immunohistochemistry-Frozen: CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of CD8+ T cells in allogeneic skin grafted onto a mouse.Flow Cytometry: CD8 alpha Antibody (53-6.7) [NBP1-49045] - Analysis of lymph nodes by multiple staining.

Rat Monoclonal
Species Mouse, Rat
Applications Flow, ICC/IF, IHC...MORE

     1 Review

5 Publications
NBP1-92684
Western Blot: Doublecortin Antibody (3E1) [NBP1-92684] - Western blot of crude rat brain extract from a postnatal 3 day animal stained with NBP1-92684. Two bands at ~45kDa and ~35kDa show that NBP1-92684 binds to an epitope in the region of Doublecortin shared by Lis-A, and Lis-B, Lis-C and Lis-D, the C terminal 360 amino acids of Lis-A.Immunocytochemistry/Immunofluorescence: Doublecortin Antibody (3E1) [NBP1-92684] - Rat brain neural cultures stained with NBP1-92684 (green), a chicken polyclonal antibody to GFAP (NB300-213, red) and DNA (blue). The NBP1-92684 antibody reveals strong cytoplasmic staining in a population of small developing neurons. These cells are often found in small clumps as in these cultures, as in this example. Note that they are not positive for MAP2, which is characteristic of more mature neurons, and that the mature neuron shown is negative for NBP1-92684. This Doublecortin antibody is therefore an excellent marker of developing neuronal cells.

Mouse Monoclonal
Species Human, Mouse, Rat...MORE
Applications WB, ICC/IF

285-IF/CF
Recombinant Human IFN-gamma  (Catalog # 285‑IF/CF) demonstrates anti-viral activity in HeLa human cervical epithelial carcinoma cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is typically 0.15‑0.75 ng/mL.1 μg/lane of Recombinant Human IFN-gamma  was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 17 kDa.


Species Human
Applications BA

140 Publications
NB120-6405
Immunocytochemistry/Immunofluorescence: MHC Class I Antibody (OX18) [NB120-6405] - PC-12 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-MHC Class I (OX18) NB120-6405 at a 1:100 dilution overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was detected with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.Flow Cytometry: MHC Class I Antibody (OX18) [NB120-6405] - Analysis using the FITC conjugate of NB120-6405. Staining of rat spleen cells with mouse anti-rat RT1-A (OX18).Flow (Intracellular): MHC Class I Antibody (OX18) [NB120-6405] - PC-12 cells were stained with MHC Class I NB120-6405 (blue) and a matched isotype control NBP2-27287 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-mouse secondary antibody.

Mouse Monoclonal
Species Rat
Applications B/N, ELISA, Flow...MORE

29 Publications
NBP2-24867
Flow (Cell Surface): CD3 Antibody (OKT3) [Azide Free] [NBP2-24867] - Analysis using the PE conjugate of NBP2-24867. Detection of CD3 expression in hPBMC's gated to lymphocyte population at 1 x 10^6 cells/ml. Cells were stained with NBP2-24867PE (orange) conjugate at a 1:500 dilution. Results are shown with mIgG (PE conjugaFlow Cytometry: CD3 Antibody (OKT3) [Azide Free] [NBP2-24867] - Surface staining of human PBMC with CD3 antibody (red) and isotype control (green) at 0.2 ug/10^6 cells.Flow Cytometry: CD3 Antibody (OKT3) [Azide Free] [NBP2-24867] - Surface staining of human PBMC with CD3 antibody (red) grown in serum-free media and isotype control (green) at 0.25 ug/10^6 cells.

Mouse Monoclonal
Species Human
Applications Flow, Func, In vitro...MORE

5 Publications
M1000B


Species Mouse

123 Publications
202-IL/CF
Recombinant Human IL-2 (Catalog # 202-IL/CF) stimulates cell proliferation of the CTLL‑2 mouse cytotoxic T cell line. The ED50 for this effect is typically 0.05-0.25 ng/mL.1 μg/lane of Recombinant Human IL-2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 13 kDa.


Species Human
Applications BA

106 Publications
D6050


Species Human

199 Publications
215-GM/CF
Recombinant Human GM-CSF (Catalog # 215-IL/CF) stimulates cell proliferation of the TF-1 human erythroleukemic cell line. The ED50 for this effect is typically 6-30 pg/mL. 1 μg/lane of Recombinant Human GM-CSF was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 14 kDa.


Species Human
Applications BA

112 Publications

Bioinformatics Tool for CD1b

Discover related pathways, diseases and genes to CD1b. Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Bioinformatics Tool
Vizit™, under license from BioVista Inc.

Research Areas for CD1b

Find related products by research area.

Blogs on CD1b

There are no specific blogs for CD1b, but you can read our latest blog posts.