CD1b Antibody 0.1 ml

CD1b NBP1-86559

Contact Information

Choose a country to view pricing and purchasing information.

More on NBP1-86559

  • CD1b Primary Antibodies
  • All CD1b Products
  • Alternate Names
     
  • Submit a Review

Ordering Information: NBP1-86559

Catalog NumberNBP1-86559
  • FormUnconjugated
  • Size(s)0.1 ml
  • Price, Shipping
    & Availability
     

     
  •  

CD1b Antibody Summary

 
Species Human
Tested Applications WB, IHC, IHC-P
Clonality Polyclonal
Host Rabbit
Gene CD1B
Purity Immunogen affinity purified
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Guarantee Plus All of our products are backed by our 100% guarantee to work for stated and predicted species and applications.
Innovator's Reward Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

CD1b Antibody Details

 
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:IHGWDSDSGTAIFLKPWSKGNFSDKEVAELEEIFRVYI FGFAREVQDFAGDFQMKYPFEIQGIAGCELHSGGAIVSFLRGAL GGLDFLSVKNASCVPSPEGGSRAQKFCALIIQYQGIMETVRILL YETCPRYLLGVLNAGKAD

Species Reactivity

 
Human

Applications/Dilutions

 
Dilutions
  • Western Blot 1:100-500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes

For HIER pH6 retrieval is recommended.

Product PDFs

Reviews

Earn rewards points by submitting your review for CD1b Antibody (NBP1-86559).
Submit a Review

Publications

Earn rewards if you have published using CD1b Antibody (NBP1-86559).
Submit a Publication

Protocols and FAQs

Controls & Support Products

Research Tools

View all CD1b Research Tools.

Packaging, Storage & Formulations

 
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer PBS, pH 7.2, containing 40% glycerol
Unit Size 0.1 ml
Concentration Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Preservative 0.02% Sodium Azide
Limitations This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

 
Gene Symbol CD1B

Alternate Names for CD1b

 
  • T-cell surface glycoprotein CD1b
  • MGC125990
  • differentiation antigen CD1-alpha-3
  • CD1A
  • cortical thymocyte antigen CD1B
  • CD1
  • R1
  • CD1b antigen
  • CD1B antigen, b polypeptide
  • MGC125991
  • CD1b molecule

Related Products by Gene