CD1b Antibody 0.1 ml

Click image to view larger
Western Blot: CD1b Antibody [NBP1-86559] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Negative control (vector only transfected HEK293T lysate)<br/>Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY419761)
Immunohistochemistry-Paraffin: CD1b Antibody [NBP1-86559] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.
Download Datasheet
See All Related

Ordering Information: NBP1-86559

  • Catalog Number
    NBP1-86559
  • Displayed Format
    Unconjugated
  • Size(s)
    0.1 ml
  • Availability
  • Price
    Shipping
  

CD1b Antibody Summary

Species Human
Tested Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Gene
CD1B
Purity
Immunogen affinity purified
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Guarantee Plus
All of our products are backed by our 100% guarantee to work for stated and predicted species and applications.
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

CD1b Antibody Details

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:IHGWDSDSGTAIFLKPWSKGNFSDKEVAELEEIFRVYIFGFAREVQDFAGDFQMKYPFEIQGIAGCELHSGGAIVSFLRGALGGLDFLSVKNASCVPSPEGGSRAQKFCALIIQYQGIMETVRILLYETCPRYLLGVLNAGKAD

Species Reactivity

Human

Applications/Dilutions

Dilutions
  • Western Blot 1:100-500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For HIER pH6 retrieval is recommended.

Contact Information

Product PDFs

Frequently Purchased Together

Reviews

Earn rewards points by submitting your review for CD1b Antibody (NBP1-86559). Be the first to review this product and earn double rewards points!

Publications

Earn rewards if you have published using CD1b Antibody (NBP1-86559).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Unit Size
0.1 ml
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Preservative
0.02% Sodium Azide
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

Gene Symbol CD1B

Alternate Names for CD1b Antibody

  • CD1
  • CD1A
  • CD1b antigen
  • CD1B antigen, b polypeptide
  • CD1b molecule
  • cortical thymocyte antigen CD1B
  • differentiation antigen CD1-alpha-3
  • MGC125990
  • MGC125991
  • R1
  • T-cell surface glycoprotein CD1b
Show More

Related Products by Gene


Reviews for CD1b Antibody (NBP1-86559) (0)

There are no reviews for CD1b Antibody (NBP1-86559).
By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image
Have you used CD1b Antibody (NBP1-86559)? Submit your review and earn rewards points which can be used for merchandise & discounts.
Points can be redeemed for discounts and gift cards:
$50/€35/£30/$50CAN Amazon Gift Card1000 Points
Items ships for Free, please disregard any shipping charges.
$50/€35/£30/$50CAN Off Purchase (credited after checkout)1000 Points
Discount is removed from total when the order is processed. The discount will not appear in your shopping cart on check out.

Publications for CD1b Antibody (NBP1-86559) (0)

There are no publications for CD1b Antibody (NBP1-86559).
By submitting a publication earn 200 points for your submission points towards our Rewards Program.
Have you published using CD1b Antibody (NBP1-86559)? Earn rewards points which can be used for merchandise & discounts.
Points can be redeemed for discounts and gift cards:
$50/€35/£30/$50CAN Amazon Gift Card1000 Points
Items ships for Free, please disregard any shipping charges.
$50/€35/£30/$50CAN Off Purchase (credited after checkout)1000 Points
Discount is removed from total when the order is processed. The discount will not appear in your shopping cart on check out.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

Ask a Scientist

Submit your question on below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
CAPTCHA
This question is for testing whether or not you are a human visitor and to prevent automated spam submissions.

FAQs for CD1b (2)

  1. In the immunohistochemistry paraffin section protocol....the PBS buffer....should it be at certain pH?
    • For IHC application, different labs cites the pH of PBS buffer in the range of 7.1 - 7.6 but most commonly used pH is pH 7.4 (this is what we use in our lab). You may use this PBS (pH 7.4) for making permeablization buffer, antibody diluent buffers and for making wash buffer. For more on the protocol that we use in our lab and for IHC-P troubleshooting suggestions, you may visit: IHC-P Protocol and IHC-P Troubleshooting.
  2. I was wondering what does Format 7C mean as far as anitbodies go?
    • 7C is a fluorophore - it is useful for FLOW. The details of the fluor are (A=425, E=500)

Customers Who Viewed This Item Also Viewed...

NBP2-31691
Western Blot: CD1E Antibody [NBP2-31691] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10&lt;br/&gt;Lane 2: Human cell line RT-4&lt;br/&gt;Lane 3: Human cell line U-251MG spImmunohistochemistry: CD1E Antibody [NBP2-31691] - liver cancerWestern Blot: CD1E Antibody [NBP2-31691] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10&lt;br/&gt;Lane 2: Human cell line RT-4&lt;br/&gt;Lane 3: Human cell line U-251MG sp

Rabbit Polyclonal
Species Human
Applications WB, IHC

H00006241-M01
Western Blot: RRM2 Antibody (1E1) [H00006241-M01] - Western Blot analysis of RRM2 expression in HeLa NE ( Cat # L013V3 ).Immunocytochemistry/Immunofluorescence: RRM2 Antibody (1E1) [H00006241-M01] - Immunofluorescence of monoclonal antibody to RRM2 on HeLa cell . [antibody concentration 10 ug/ml]Immunohistochemistry-Paraffin: RRM2 Antibody (1E1) [H00006241-M01] - Immunoperoxidase of monoclonal antibody to RRM2 ( Cat # H00006241-M01 ) on formalin-fixed paraffin-embedded human stomach. [antibody concentration 1.5 ug/ml]

Mouse Monoclonal
Species Human
Applications WB, ELISA, ICC/IF...MORE

4 Publications
MAB4616
Flow Cytometry: CD82/Kai-1 Antibody (423524) [MAB4616] - Human whole blood granulocytes were stained with Mouse Anti-Human CD82/Kai-1 Monoclonal Antibody (R&amp;D catalog # MAB4616, filled histogram) or isotype control antibody (R&amp;D catalog # MAB002, open histogram), followed by Phycoerythrin-conjugated Anti-Mouse IgG F(ab')2 Secondary Antibody (R&amp;D catalog # F0102B).

Mouse Monoclonal
Species Human
Applications FLOW

1 Publication
MAB6979
Western Blot: CD1d Antibody (703335) [MAB6979] - Lysates of human peripheral blood mononuclear cells (PBMC). PVDF membrane was probed with 2 ug/mL of Mouse Anti-Human CD1d Monoclonal Antibody (R&amp;D catalog # MAB6979) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (R&amp;D catalog # HAF007). A specific band was detected for CD1d at approximately 52 kDa (as indicated). This experiment was conducted under reducing conditions.

Mouse Monoclonal
Species Human
Applications WB

NBP2-31143
Western Blot: CTLA4 Antibody (37B3D8.2F2) [NBP2-31143] - WB analysis of CTLA-4 protein on (A) mouse Kidney lysate (B) human Kidney lysate and on &amp;#169; partial recombinant protein using CTLA-4 monoclonal antibody at a concentration of 2 ug/ml.

Mouse Monoclonal
Species Human, Mouse
Applications WB

NB100-65423
Flow Cytometry: HLA DQ/DR Antibody (49.1) [NB100-65423] - Staining of sheep peripheral blood lymphocytes with MOUSE ANTI OVINE MHC CLASS II DQ/DR (POLYMORPHIC).

Mouse Monoclonal
Species Human, Bovine, Goat...MORE
Applications FLOW, IHC, IHC-Fr...MORE

NB100-524
Western Blot: NOD2 Antibody (2D9) [NB100-524] - Detection of endogenous NOD2 in 50ug of HT29 cell lysate using NB 100-524. ECL detection in 15 minutes.Immunocytochemistry/Immunofluorescence: NOD2 Antibody (2D9) [NB100-524] - analysis of PFA fixed mouse sciatic nerve section using anti-NOD2 antibody. Image from verified customer review. Western Blot: NOD2 Antibody (2D9) [NB100-524] - Detection of NOD2 in 20ug of NOD2 transfected 293T cell lysate using NB 100-524. ECL detection in 10 seconds.

Mouse Monoclonal
Species Human, Mouse
Applications WB, ICC/IF, IHC...MORE

     1 Review

12 Publications
AF-410-NA
Immunocytochemistry/Immunofluorescence: TNF-alpha Antibody [AF-410-NA] - TNF- alpha was detected in immersion fixed activated mouse T Cells using 15 ug/mL Mouse TNF- alpha Antigen Affinity-purified Polyclonal Antibody (R&amp;D catalog # AF-410-NA) for 3 hours at room temperature. Cells were stained (red) and counterstained (green).Immunocytochemistry/Immunofluorescence: TNF-alpha Antibody [AF-410-NA] - TNF- alpha was detected in immersion fixed RAW 264.7 mouse monocyte/ macrophage cell line treated with LPS using Mouse TNF- alpha Antigen Affinity-purified Polyclonal Antibody (R&amp;D catalog # AF-410-NA) at 10 ug/mL for 3 hours at room temperature. Cells were stained using the NorthernLights&amp;#8482; 557-conjugated Anti-Goat IgG Secondary Antibody (red; R&amp;D catalog # NL001) and counterstained with DAPI (blue).Blocking/Neutralizing: TNF-alpha Antibody [AF-410-NA] - Recombinant Mouse TNF- alpha (R&amp;D catalog # 410-MT) induces cytotoxicity in the the L-929 mouse fibroblast cell line in a dose-dependent manner (orange line). Cytotoxicity elicited by Recombinant Mouse TNF- alpha (0.25 ng/mL) is neutralized (green line) by increasing concentrations of Mouse TNF- alpha Antigen Affinity-purified Polyclonal Antibody (R&amp;D catalog # AF-410-NA). The ND50 is typically 0.1-0.4 ug/mL in the presence of the metabolic inhibitor actinomycin D (1 ug/mL).

Goat Polyclonal
Species Mouse
Applications WB, B/N, ICC/IF...MORE

39 Publications
AF-204-NA
Blocking/Neutralizing: IL-4 Antibody [AF-204-NA] - Recombinant Human IL-4 (R&amp;D catalog # 204-IL) stimulates proliferation in the TF-1 human erythroleukemic cell line in a dose-dependent manner (orange line). Proliferation elicited by Recombinant Human IL-4 (0.5 ng/mL) is neutralized (green line) by increasing concentrations of Human IL-4 Antigen Affinity-purified Polyclonal Antibody (R&amp;D catalog # AF-204-NA). The ND50 is typically 0.02-0.1 ug/mL.

Goat Polyclonal
Species Human
Applications WB, B/N

7 Publications
NBP2-25199
Flow Cytometry: CD4 Antibody (RPA-T4) [NBP2-25199] - Cell surface flow analysis of CD4 in human PBMC using this antibody at 0.25 ug/10^6 cells. Cells were stained with primary antibody followed by a PE-conjugated goat anti-mouse secondary antibody this antibody . Green represents isotype control this antibody ; red represents anti-CD4 antibody. Cells in the lymphocyte gate were used for analysis.

Mouse Monoclonal
Species Human
Applications B/N, FLOW, IHC...MORE

     1 Review

NBP2-25195
Flow Cytometry: CD8 alpha Antibody (RPA-T8) [NBP2-25195] - Cell surface flow analysis of CD8 in human PBMC using this antibody at 0.25 ug/10^6 cells. Cells were stained with primary antibody followed by a PE-conjugated goat anti-mouse secondary antibody this antibody . Green represents isotype control this antibody ; red represents anti-CD8 this antibody.

Mouse Monoclonal
Species Human
Applications FLOW

NBP1-92684
Western Blot: Doublecortin Antibody (3E1) [NBP1-92684] - Western blot of crude rat brain extract from a postnatal 3 day animal stained with NBP1-92684. Two bands at ~45kDa and ~35kDa show that NBP1-92684 binds to an epitope in the region of Doublecortin shared by Lis-A, and Lis-B, Lis-C and Lis-D, the C terminal 360 amino acids of Lis-A.Immunocytochemistry/Immunofluorescence: Doublecortin Antibody (3E1) [NBP1-92684] - Rat brain neural cultures stained with NBP1-92684 (green), a chicken polyclonal antibody to GFAP (NB300-213, red) and DNA (blue). The NBP1-92684 antibody reveals strong cytoplasmic staining in a population of small developing neurons. These cells are often found in small clumps as in these cultures, as in this example. Note that they are not positive for MAP2, which is characteristic of more mature neurons, and that the mature neuron shown is negative for NBP1-92684. This Doublecortin antibody is therefore an excellent marker of developing neuronal cells.

Mouse Monoclonal
Species Human, Mouse, Rat...MORE
Applications WB, ICC/IF

AF-285-NA
Immunocytochemistry/Immunofluorescence: IFN-gamma Antibody [AF-285-NA] - IFN- gamma was detected in immersion fixed human peripheral blood mononuclear cells (PBMCs) stimulated with PMA and ionomycin using 10 ug/mL Human IFN- gamma Antigen Affinity-purified Polyclonal Antibody (R&amp;D catalog # AF-285-NA) for 3 hours at room temperature. Cells were stained with the NorthernLights&amp;#8482; 557-conjugated Anti-Goat IgG Secondary Antibody (red; R&amp;D catalog # NL001) and counterstained with DAPI (blue).Blocking/Neutralizing: IFN-gamma Antibody [AF-285-NA] - Recombinant Human IFN- gamma (R&amp;D catalog # 285-IF) reduces the Encephalomyocarditis Virus (EMCV)-induced cytopathy in the HeLa human cervical epithelial carcinoma cell line in a dose-dependent manner (orange line), as measured by crystal violet staining. Inhibition of EMCV activity elicited by Recombinant Human IFN- gamma (5 ng/mL) is neutralized (green line) by increasing concentrations of Human IFN- gamma Antigen Affinity-purified Polyclonal Antibody (R&amp;D catalog # AF-285-NA). The ND50 is typically 0.1-0.3 ug/mL.

Goat Polyclonal
Species Human
Applications WB, B/N, ICC/IF

9 Publications
NB120-6405
Flow Cytometry: MHC Class I Antibody (OX18) [NB120-6405] - Staining of rat spleen cells with MOUSE ANTI RAT RT1A ( CLASS I MONOMORPHIC): FITC

Mouse Monoclonal
Species Rat
Applications ELISA, FLOW, ICC/IF...MORE

9 Publications
NBP1-72167
Immunohistochemistry-Paraffin: CD3 Antibody [NBP1-72167] - Human tonsil tissue stained with Anti-CD3 antibody at 1:100 for 10 min @ RT. Staining of formalin-fixed tissue requires boiling tissue sections in 10 mM Citrate Buffer, pH 6.0 for 10 min followed by cooling at RT for 20 min.Simple Western: CD3 Antibody [NBP1-72167] - Simple Western lane view shows a specific band for CD3 in 0.05 mg/ml of Jurkat lysate.  This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Rabbit Polyclonal
Species Human, Mouse, Rat
Applications WB, Simple Western, ELISA...MORE

3 Publications
AF-217-NA
Immunohistochemistry-Paraffin: IL-10 Antibody [AF-217-NA] - IL-10 was detected in immersion fixed paraffin-embedded sections of human tonsil using Goat Anti-Human IL-10 Antigen Affinity-purified Polyclonal Antibody (R&amp;D catalog # AF-217-NA) at 15 ug/mL overnight at 4 &amp;deg;C. Tissue was stained using the Anti-Goat HRP-DAB Cell &amp; Tissue Staining Kit (brown; R&amp;D catalog # CTS008) and counterstained with hematoxylin (blue).Immunohistochemistry-Paraffin: IL-10 Antibody [AF-217-NA] - IL-10 was detected in immersion fixed paraffin-embedded sections of human tonsil using Goat Anti-Human IL-10 Antigen Affinity-purified Polyclonal Antibody (R&amp;D catalog # AF-217-NA) at 15 ug/mL overnight at 4 &amp;deg;C. Tissue was stained using the Anti-Goat HRP-DAB Cell &amp; Tissue Staining Kit (brown; R&amp;D catalog # CTS008) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents.Blocking/Neutralizing: IL-10 Antibody [AF-217-NA] - Recombinant Human IL-10 (R&amp;D catalog # 217-IL) stimulates proliferation in the MC/9-2 mouse mast cell line in a dose-dependent manner (orange line). Proliferation elicited by Recombinant Human IL-10 (5 ng/mL) is neutralized (green line) by increasing concentrations of Goat Anti-Human IL-10 Antigen Affinity-purified Polyclonal Antibody (R&amp;D catalog # AF-217-NA). The ND50 is typically 0.2-1.0 ug/mL.

Goat Polyclonal
Species Human
Applications IHC-P, IHC, B/N...MORE

11 Publications
NBP2-16948
Western Blot: IL2 Antibody [NBP2-16948] - Sample (30 ug of whole cell lysate) A: Raji 15% SDS PAGE gel, diluted at 1:500.Immunohistochemistry-Paraffin: IL2 Antibody [NBP2-16948] - Human tonsil. Image from verified customer review.Immunohistochemistry-Paraffin: IL2 Antibody [NBP2-16948] - Immunohistochemical analysis of paraffin-embedded Gastric ca, using antibody at 1:500 dilution.

Rabbit Polyclonal
Species Human
Applications IHC-P, IHC, WB

     1 Review

AF-206-NA
Immunocytochemistry/Immunofluorescence: IL-6 Antibody [AF-206-NA] - IL-6 was detected in immersion fixed human peripheral blood mononuclear cells (PBMCs) treated with LPS and monensin using Goat Anti-Human IL-6 Antigen Affinity-purified Polyclonal Antibody (R&amp;D catalog # AF-206-NA) at 10 ug/mL for 3 hours at room temperature. Cells were stained using the NorthernLights&amp;#8482; 557-conjugated Anti-Goat IgG Secondary Antibody (red; R&amp;D catalog # NL001) and counterstained with DAPI (blue).Blocking/Neutralizing: IL-6 Antibody [AF-206-NA] - Recombinant Human IL-6 (R&amp;D catalog # 206-IL) stimulates proliferation in the T1165.85.2.1 mouse plasmacytoma cell line in a dose-dependent manner (orange line). Proliferation elicited by Recombinant Human IL-6 (2.5 ng/mL) is neutralized (green line) by increasing concentrations of Goat Anti-Human IL-6 Antigen Affinity-purified Polyclonal Antibody (R&amp;D catalog # AF-206-NA). The ND50 is typically 15-45 ng/mL.

Goat Polyclonal
Species Human
Applications WB, B/N, ICC/IF

     3 Reviews

15 Publications
NBP2-34893


Species Human
Applications Func, PAGE

Bioinformatics Tool for CD1b

Discover related pathways, diseases and genes to CD1b. Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Bioinformatics Tool

Research Areas for CD1b

Find related products by research area.

Blogs on CD1b

There are no specific blogs for CD1b, but you can read our latest blog posts.