CD11d Antibody 0.1 ml

CD11d NBP1-90237

Contact Information

Choose a country to view pricing and purchasing information.

More on NBP1-90237

  • All CD11d Products
  • Alternate Names
     
  • Submit a Review

Ordering Information: NBP1-90237

Catalog NumberNBP1-90237
  • FormUnconjugated
  • Size(s)0.1 ml
  • Price, Shipping
    & Availability
     

     
  •  

CD11d Antibody Summary

 
Species Human
Tested Applications IHC, IHC-P
Clonality Polyclonal
Host Rabbit
Gene ITGAD
Purity Immunogen affinity purified
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Guarantee Plus All of our products are backed by our 100% guarantee to work for stated and predicted species and applications.
Innovator's Reward Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

CD11d Antibody Details

 
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RCWEEKPSALEAGDATVCLTIQKSSLDQLGDIQSSVRF DLALDPGRLTSRAIFNETKNPTLTRRKTLGLGIHCETLKLLLPD CVEDVVSPIILHLNFSLV

Species Reactivity

 
Human

Applications/Dilutions

 
Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes

For IHC-Paraffin, HIER pH6 retrieval is recommended.

Positive Controls

1 Positive Control

Product PDFs

Reviews

Earn rewards points by submitting your review for CD11d Antibody (NBP1-90237).
Submit a Review

Publications

Earn rewards if you have published using CD11d Antibody (NBP1-90237).
Submit a Publication

Protocols and FAQs

Controls & Support Products

Research Tools

View all CD11d Research Tools.

Packaging, Storage & Formulations

 
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer PBS, pH 7.2, containing 40% glycerol
Unit Size 0.1 ml
Concentration Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Preservative 0.02% Sodium Azide
Limitations This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

 
Gene Symbol ITGAD
Entrez
Uniprot

Alternate Names for CD11d

 
  • integrin alpha-D
  • leukointegrin alpha D
  • FLJ39841
  • CD11D
  • ADB2
  • CD11 antigen-like family member D
  • integrin, alpha D

Related Products by Gene