C4 binding protein A Antibody (H00000722-D01P)
C4 binding protein A Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-C4BP antibody, anti-PRP antibody, |
|
|
C4 binding protein A Antibody Summary: | | Gene: | C4BPA |
|---|
| Purity: | Protein A purified |
|---|
| Host: | Rabbit |
|---|
| | Specificity: | Reacts with complement component 4 binding protein, alpha. |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional C4 binding protein A Products C4 binding protein A Antibody Details: | Immunogen: | C4BPA (NP_000706.1, 1 a.a. ~ 597 a.a) full-length human protein. |
|---|
| Epitope: | MHPPKTPSGALHRKRKMAAWPFSRLWKVSD PILFQMTLIAALLPAVLGNCGPPPTLSFAA PMDITLTETRFKTGTTLKYTCLPGYVRSHS TQTLTCNSDGEWVYNTFCIYKRCRHPGELR NGQVEIKTDLSFGSQIEFSCSEGFFLIGST TSRCEVQDRGVGWSHPLPQCEIVKCKPPPD IRNGRHSGEENFYAYGFSVTYSCDPRFSLL GHASISCTVENETIGVWRPSPPTCEKITCR KPDVSHGEMVSGFGP |
|---|
| Uses: | This antibody is reactive against tissue and transfected lysate in western blot, and as a detection antibody in ELISA. |
|---|
| Dilutions: | ELISA,
Western Blot |
|---|
| Unit Size: | 0.1 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Store at -20 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: This gene encodes a member of a superfamily of proteins composed predominantly of tandemly arrayed short consensus repeats of approximately 60 amino acids. Along with a single, unique beta-chain, seven identical alpha-chains encoded by this gene assemble into the predominant isoform of C4b-binding protein, a multimeric protein that controls activation of the complement cascade through the classical pathway. The genes encoding both alpha and beta chains are located adjacent to each other on human chromosome 1 in the regulator of complement activation gene cluster. Two pseudogenes of this gene are also found in the cluster. [provided by RefSeq]
|
Images (2) Reviews (0) Related Products (13) Exploring C4 binding protein A
|
Jump to: Images, Ask a Question
|
Working with C4 binding protein A
C4 binding protein A Antibody Images (2) Western Blot analysis of C4BPA expression in transfected 293T cell line by C4BPA MaxPab rabbit polyclonal antibody.
Lane 1: C4BPA transfected lysate(67.00 KDa).
Lane 2: Non-transfected lysate.
|  C4BPA MaxPab rabbit polyclonal antibody. Western Blot analysis of C4BPA expression in mouse kidney. |
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about C4 binding protein A? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, Secondary Antibodies
|
Related ProductsLysates (3)Peptides and ProteinsPrimary Antibodies (8)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Rabbit IgG Antibody [HRP] | NB730-H | Rb | ELISA, ICC, IHC-P, WB | | (5) | | | | Rabbit IgG Antibody [FITC] | NB730-F | Rb | ICC, IHC-P | | (1) | | | | Rabbit IgG Antibody [Biotin] | NB730-B | Rb | ELISA, ICC, IHC-P, WB | | | | | | Rabbit IgG, H/L Chains Antibody [DyLight 488] | NBP1-72944 | Rb | FLISA, IF, WB | (3) | | | | | Rabbit IgG Antibody [Alkaline Phosphatase] | NB730-AP | Rb | ELISA, ICC, IHC-P, WB | | (1) | | | | See All » |
|
Jump to: Novus Explorer, Research Areas
| C4 binding protein A in Context
Research Areas related to C4 binding protein A (2): |
|
Novus Explorer for C4 binding protein A gene
|
|
