Bmi1 Antibody 0.1 ml

Bmi1 NBP1-87321

Contact Information

Choose a country to view pricing and purchasing information.

More on NBP1-87321

  • All Bmi1 Products
  • Alternate Names
     
  • Submit a Review

Ordering Information

Catalog Number  NBP1-87321

Availability  Discontinued

Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

Or feel free to contact us for alternative products.

View other Bmi1 Products
View other Bmi1 Primary Antibodies

Bmi1 Antibody Summary

 
Species Human
Tested Applications WB, ICC/IF, IHC, IHC-P
Clonality Polyclonal
Host Rabbit
Gene BMI1
Purity Immunogen affinity purified
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Guarantee Plus All of our products are backed by our 100% guarantee to work for stated and predicted species and applications.
Innovator's Reward Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Bmi1 Antibody Details

 
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGI PSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFA NRPRKSSVNGSSATSSG

Species Reactivity

 
Human

Applications/Dilutions

 
Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:10-1:2000
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes

This antibody is useful for Immunohistochemistry-Paraffin, Western Blot and Immunofluorescence. For IHC-Paraffin HIER pH6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.

Product PDFs

Reviews

Earn rewards points by submitting your review for Bmi1 Antibody (NBP1-87321).
Submit a Review

Publications

Earn rewards if you have published using Bmi1 Antibody (NBP1-87321).
Submit a Publication

Controls & Support Products

Research Tools

View all Bmi1 Research Tools.

Packaging, Storage & Formulations

 
Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer PBS, pH 7.2, containing 40% glycerol
Unit Size 0.1 ml
Concentration Concentrations vary lot to lot. See vial label for concentration.
Preservative 0.02% Sodium Azide
Limitations This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

 
Gene Symbol BMI1

Alternate Names for Bmi1

 
  • polycomb group protein Bmi1
  • FLVI2/BMI1
  • polycomb complex protein BMI-1
  • polycomb group ring finger 4
  • murine leukemia viral (bmi-1) oncogene homolog
  • B lymphoma Mo-MLV insertion region 1 homolog (mouse)
  • B lymphoma Mo-MLV insertion region 1 homolog
  • PCGF4
  • RING finger protein 51
  • RNF51Polycomb group RING finger protein 4
  • MGC12685
  • BMI1 polycomb ring finger oncogene

Related Products by Gene