We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Recombinant Human Bestrophin 1 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Bestrophin 1 Peptides and Proteins

Order Details


    • Catalog Number
      H00007439-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Bestrophin 1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acids 361-460 of Human VMD2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LHEGLPKNHKAAKQNVRGQEDNKAWKLKAVDAFKSAPLYQRPGYYSAPQTPLSPTPMFFPLEPSAPSKLHSVTGIDTKDKSLKTVSSGAKKSFELLSESD

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
BEST1

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Bestrophin 1 Protein

  • ARB
  • Best disease
  • BEST
  • bestrophin 1
  • bestrophin-1
  • BMD
  • TU15B
  • vitelliform macular dystrophy 2
  • Vitelliform macular dystrophy protein 2
  • VMD2RP50

Background

VMD2 - vitelliform macular dystrophy 2 (Best disease, bestrophin)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1419
Species: Hu, Rt
Applications: CyTOF-ready, ICC, IHC, ICFlow
MAB7665
Species: Hu
Applications: IHC, WB
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
NBP1-86713
Species: Hu
Applications: IHC,  IHC-P
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
291-G1
Species: Hu
Applications: BA
NBP1-89953
Species: Hu
Applications: IHC,  IHC-P
DY805
Species: Hu
Applications: ELISA
NBP2-20383
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP2-02623
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr,  IHC-P, WB
462-TEC
Species: Mu
Applications: BA
M6000B
Species: Mu
Applications: ELISA
DPI00
Species: Hu
Applications: ELISA
NB110-3638
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, RI, WB
NBP2-92749
Species: Hu, Mu
Applications: ELISA, WB

Publications for Bestrophin 1 Partial Recombinant Protein (H00007439-Q01) (0)

There are no publications for Bestrophin 1 Partial Recombinant Protein (H00007439-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Bestrophin 1 Partial Recombinant Protein (H00007439-Q01) (0)

There are no reviews for Bestrophin 1 Partial Recombinant Protein (H00007439-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Bestrophin 1 Partial Recombinant Protein (H00007439-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Bestrophin 1 Products

Research Areas for Bestrophin 1 Partial Recombinant Protein (H00007439-Q01)

Find related products by research area.

Blogs on Bestrophin 1.

Vision Infographic: Do you see how I see?
Vision involves several parts of the eye processing light which send signals to the brain via the optic nerve to process information. Learn more about the vision process and related ocular proteins in the infographic below. Novus Biological...  Read full blog post.

Bestrophin 1: Implications in Progressive Vision Loss
The human Bestrophin family has four members, Best1, Best2, Best3 and Best4. These transmembrane proteins can function as chloride channels, and can also regulate calcium channels (1). The Bestrophins all have a conserved domain which begins at the N-...  Read full blog post.

"I can see clearly now": Targeting Bestrophin 1 to treat Bestrophinopathies
Encoded by the VMD2 gene on chromosome 11q13 Bestrophin 1 is the prototypic member of the RFP family of proteins which are more commonly called "bestrophins". The protein family was originally identified in Caenorhabditis elegans based on a conserved ...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Bestrophin 1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol BEST1