BNIP3 Antibody (H00000664-D01P)

BNIP3 Antibody

100% Guarantee This product is fully covered under the Novus guarantee+ Policy. Click here for details.

Distributor Data...

Loading Ajax

This Product Has Been Discontinued

The Following Alternate Products are Available:

BNIP3 Antibody Summary:
Species:Hu
Applications:WB
Clonality:Polyclonal
Gene:BNIP3
Purity:Protein G purified
Host:Rabbit
 
 
Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.
View Additional BNIP3 Products
BNIP3 Antibody Details:
Immunogen:BNIP3 (NP_004043.2, 1 a.a. ~ 194 a.a) full-length human protein.
Epitope:MSQNGAPGMQEESLQGSWVELHFSNNGNGG SVPASVSIYNGDMEKILLDAQHESGRSSSK SSHCDSPPRSQTPQDTNRASETDTHSIGEK NSSQSEEDDIERRKEVESILKKNSDWIWDW SSRPENIPPKEFLFKHPKRTATLSMRNTSV MKKGGIFSAEFLKVFLPSLLLSHLLAIGLG IYIGRRLTTSTSTF
Species Reactivity:

This product is reactive against Human.

Applications:
Uses:This antibody is useful for Western Blot
Dilutions:Western Blot
Unit Size:0.1 mg
Concentration:Please see the vial label for concentration.
Notes:
This product is produced by and distributed for Abnova, a company based in Taiwan.
Packaging:
Storage:Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:In 1x PBS, pH 7.2
Preservative:No Preservative
Limitations:This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.
Gene Symbol: BNIP3
Swiss ProtNP_004043.2 (Human)
 
Background:

BNIP3, formerly NIP3 (nineteen kDa interacting protein-3), is a pro-apoptotic, mitochondrial protein classified in the Bcl 2 family based on limited sequence homology to the Bcl 2 homology 3 (BH3) domain (amino acids 110-118) and C-terminal TM domain. BNIP3 expressed in yeast and mammalian cells interacts with survival promoting proteins Bcl 2, Bcl XL, CED9 and the adenovirus E1B 19K protein. Typically the BH3 domain of pro-apoptotic Bcl-2 homologues mediates Bcl 2/Bcl XL heterodimerization and confers pro-apoptotic activity. BNIP3 represents a subfamily of Bcl 2 related proteins, which functions without a typical BH3 domain to regulate apoptosis from both mitochondrial and nonmitochondrial sites by selective Bcl 2/Bcl XL interactions. The N-terminus (residues 1-49) and the C-terminus TM domain of BNIP3 are critical for Bcl 2 heterodimerization, and either region is sufficient for Bcl XL interaction. The TM domain of BNIP3 is critical for homodimerization, pro-apoptotic function, and mitochondrial targeting. BNIP3 contains PEST sequences suggesting that the protein may be susceptible to rapid degradation by proteases. PEST sequences commonly contain high local concentrations of amino acids P, E, S, T, and D flanked by charged amino acids and these are abundantly present in NIP3. Thus, the posttranslational control of BNIP3 expression through rapid protein degradation may constitute a mechanism for regulating the intracellular levels of a potentially lethal protein.

Jump to: Ask a Question

Working with BNIP3

BNIP3 Antibody Images (0)
Reviews (0)  Have you used this product? Review this product to earn Novus Rewards.

Ask a Scientist

Can't find an answer to your question about BNIP3? Ask us by using live chat or by submitting your questions below:

 
Jump to: Lysates, Primary Antibodies, Secondary Antibodies

Related Products

Lysates (2)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
BNIP3 LysateNBL1-08014WB(1)

BNIP3 LysateH00000664-T05WB

Primary Antibodies (13)
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
BNIP3 AntibodyNBP1-77683Hu, MuICC, IF, IHC-P(2)

BNIP3 AntibodyNB110-60562Fe, Hu, Mu(-)ICC, IF, WB(2)(1)

BNIP3 Antibody (EPR4034)NBP1-95586Hu, Mu, RtICC, IF, IHC-P, WB(3)

BNIP3 AntibodyNBP1-82566HuIF, IHC-P, WB(3)

BNIP3 AntibodyR-1093-100Hu, Mu, RtIHC-P, WB(1)

... and 8 more. See All »
Secondary Antibodies
NameCatalog#ReactivityApplicationsImagesPublicationsReviews
Rabbit IgG Antibody [HRP]NB730-HRbELISA, ICC, IHC-P, WB(5)

Rabbit IgG Antibody [FITC]NB730-FRbICC, IHC-P(1)

Rabbit IgG Antibody [Biotin]NB730-BRbELISA, ICC, IHC-P, WB

Rabbit IgG, H/L Chains Antibody [DyLight 488]NBP1-72944RbFLISA, IF, WB(3)

Rabbit IgG Antibody [Alkaline Phosphatase]NB730-APRbELISA, ICC, IHC-P, WB(1)

See All »

Jump to: Novus Explorer, Research Areas

BNIP3 in Context


Research Areas related to BNIP3 (5):
Novus Explorer for BNIP3 gene

Try our bioinformatic tool that shows the relationships between BNIP3 and other genes, diseases, pathways and post-translational modifications.