BMI-1 Antibody 0.1 ml

Click image to view larger
Western Blot: BMI-1 Antibody [NBP1-87321] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/Immunofluorescence: BMI-1 Antibody [NBP1-87321] - Staining of human cell line A-431 shows positivity in nucleus.
Immunohistochemistry-Paraffin: BMI-1 Antibody [NBP1-87321] - Staining of human kidney shows strong nuclear positivity in cells in tubules.
Western Blot: BMI-1 Antibody [NBP1-87321] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG sp
Download Datasheet
See All Related

Ordering Information: NBP1-87321

  • Catalog Number
    NBP1-87321
  • Displayed Format
    Unconjugated
  • Size(s)
    0.1 ml
  • Availability
  • Price
    Shipping
  

BMI-1 Antibody Summary

Species Human
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee
Tested Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Gene
BMI1
Purity
Immunogen affinity purified
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Guarantee Plus
All of our products are backed by our 100% guarantee to work for stated and predicted species and applications.
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

BMI-1 Antibody Details

Isotype
IgG
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
This antibody is useful for Immunohistochemistry-Paraffin, Western Blot and Immunofluorescence. For IHC-Paraffin HIER pH6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
BMI-1 Protein (NBP1-87321PEP)

Contact Information

Product PDFs

Frequently Purchased Together

Reviews

Earn rewards points by submitting your review for BMI-1 Antibody (NBP1-87321). Be the first to review this product and earn double rewards points!

Publications

Earn rewards if you have published using BMI-1 Antibody (NBP1-87321).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Unit Size
0.1 ml
Concentration
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
Preservative
0.02% Sodium Azide
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

Gene Symbol BMI1
Entrez
Uniprot

Alternate Names for BMI-1 Antibody

  • B lymphoma Mo-MLV insertion region 1 homolog (mouse)
  • B lymphoma Mo-MLV insertion region 1 homolog
  • BMI1 polycomb ring finger oncogene
  • FLVI2/BMI1
  • MGC12685
  • murine leukemia viral (bmi-1) oncogene homolog
  • PCGF4
  • polycomb complex protein BMI-1
  • polycomb group protein Bmi1
  • polycomb group ring finger 4
  • RING finger protein 51
  • RNF51
  • RNF51Polycomb group RING finger protein 4
Show More

Related Products by Gene


Reviews for BMI-1 Antibody (NBP1-87321) (0)

There are no reviews for BMI-1 Antibody (NBP1-87321).
By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image
Have you used BMI-1 Antibody (NBP1-87321)? Submit your review and earn rewards points which can be used for merchandise & discounts.
Points can be redeemed for discounts and gift cards:
$50/€35/£30/$50CAN Amazon Gift Card1000 Points
Items ships for Free, please disregard any shipping charges.
$50/€35/£30/$50CAN Off Purchase (credited after checkout)1000 Points
Discount is removed from total when the order is processed. The discount will not appear in your shopping cart on check out.

Publications for BMI-1 Antibody (NBP1-87321) (0)

There are no publications for BMI-1 Antibody (NBP1-87321).
By submitting a publication earn 200 points for your submission points towards our Rewards Program.
Have you published using BMI-1 Antibody (NBP1-87321)? Earn rewards points which can be used for merchandise & discounts.
Points can be redeemed for discounts and gift cards:
$50/€35/£30/$50CAN Amazon Gift Card1000 Points
Items ships for Free, please disregard any shipping charges.
$50/€35/£30/$50CAN Off Purchase (credited after checkout)1000 Points
Discount is removed from total when the order is processed. The discount will not appear in your shopping cart on check out.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

Ask a Scientist

Submit your question on below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
CAPTCHA
This question is for testing whether or not you are a human visitor and to prevent automated spam submissions.

FAQs for BMI-1 (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Viewed This Item Also Viewed...

NB200-106
Western Blot: p19ARF Antibody [NB200-106] - WB analysis of p19ARF in 1. NIH/3T3 and B. MEF cell lysate.Immunocytochemistry/Immunofluorescence: p19ARF Antibody [NB200-106] - p19ARF antibody was tested in MEF cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).

Rabbit Polyclonal
Species Mouse
Applications WB, ELISA, ICC/IF...MORE

39 Publications
NBP1-96140
Western Blot: BMI-1 Antibody (LLBmi1-1) [NBP1-96140] - BMI-1 expression in human cell lines (MCF-7, K562 and A459). Image from verified customer review.Immunocytochemistry/Immunofluorescence: Bmi1 Antibody (LLBmi1-1) [NBP1-96140] - Bmi1 antibody was tested in U2OS cells with FITC (green). Nuclei and alpha-tubulin were counterstained with Dapi (blue) and Dylight 550 (red).Western Blot: Bmi1 Antibody (LLBmi1-1) [NBP1-96140] - Western blot analysis of Bmi1 expression in 1) U2OS and 2) K562 whole cell lysates using NBP1-96140.

Mouse Monoclonal
Species Human, Mouse
Applications WB, ChIP, ICC/IF...MORE

     1 Review

1 Publication
NB110-83976
Western Blot: KMT6/EZH2 Antibody [NB110-83976] - Detection of E2H2 in Jurkat whole cell lysate using NB110-83976.

Rabbit Polyclonal
Species Human, Mouse, Primate
Applications WB

     1 Review

NB600-302
Western Blot: c-Myc Antibody (9E10) [NB600-302] - Analysis of c-myc in Jurkat cell lysates using NB600-302.Immunocytochemistry/Immunofluorescence: c-Myc Antibody (9E10) [NB600-302] - HeLa cells stained NB600-302 (Green) detected with DyLight Fluor 488 conjugated anti-mouse IgG secondary antibody.  Nuclei are counterstained with Hoechst 33258 (Blue).Flow Cytometry: c-Myc Antibody (9E10) [NB600-302] - Analysis of transgenic Eu-Myc+ mouse splenocytes using c-Myc PE conjugated antibody. Image from verified customer review.

Mouse Monoclonal
Species Human, Mouse, Drosophila
Applications WB, Simple Western, ChIP...MORE

     3 Reviews

22 Publications
NBP1-70148
Western Blot: Carboxypeptidase Y Antibody [NBP1-70148] - Lane 1: Carboxypeptidase Y. Lane 2: None. Load: 50 ng per lane. Primary antibody: Carboxypeptidase Y primary antibody at 1:1,000 overnight at 4C. Secondary antibody: Peroxidase rabbit secondary antibody at 1:40,000 for 30 min at RT. Block: incubated with blocking buffer for 30 min at RT. Predicted/Observed size: 53 kDa, 57 kDa for Carboxypeptidase Y. Other band(s): None.Western Blot: Carboxypeptidase Y Antibody [NBP1-70148] - Analysis using the HRP conjugate of NBP1-70148. Detection of Lane 1: Carboxypeptidase Y. Lane 2: none. Load: 100 ug per lane. Primary antibody: none. Secondary antibody: Peroxidase rabbit Carboxypeptidase Y antibody at 1:1,000 for 60 min at RT Block: MB-070 for 30 min at RT. Predicted/Observed size: 53 kDa for Carboxypeptidase Y.Western Blot: Carboxypeptidase Y Antibody [NBP1-70148] - Lane 1: cellular extracts. Lane 2: none. Load: 10 ug per lane. Primary antibody: Carboxypeptidase Y antibody at 1:5000 for overnight at 4C. Secondary antibody: HRP Goat-a-Rabbit IgG [H&L] secondary antibody at 1:4,000 for 45 min at RT. Block: 5% BLOTTO overnight at 4C. Predicted/Observed size: 61 kDa, 61 kDa for Carboxypeptidase Y. Other band(s): none.

Rabbit Polyclonal
Species Yeast
Applications WB, ELISA

     1 Review

NB100-1240
Western Blot: MEL-18 Antibody [NB100-1240] - Analysis of MEL-18 in Human Lung lysate using this antibody at 1 ug/ ml.

Goat Polyclonal
Species Human
Applications WB, PEP-ELISA

1 Publication
H00006045-M06
Western Blot: RNF2 Antibody (4A9) [H00006045-M06] - Analysis of RNF2 expression in NIH/3T3 (Cat # L018V1).Immunocytochemistry/Immunofluorescence: RNF2 Antibody (4A9) [H00006045-M06] - Analysis of monoclonal antibody to RNF2 on HeLa cell. Antibody concentration 10 ug/mlWestern Blot: RNF2 Antibody (4A9) [H00006045-M06] - Analysis of RNF2 expression in PC-12 (Cat # L012V1).

Mouse Monoclonal
Species Human, Mouse, Rat
Applications WB, ELISA, ICC/IF...MORE

NBP2-37370
Western Blot: RING1 Antibody (8C12F4) [NBP2-37370] - Western blot analysis using Ring1 mouse mAb against MOLT-4 (1), LNCaP (2), Hela (3), HEK-293 (4) and Jurkat (5) cell lysate.Immunohistochemistry: RING1 Antibody (8C12F4) [NBP2-37370] - Immunohistochemical analysis of paraffin-embedded cervical cancer tissues using Ring1 mouse mAb with DAB staining.Flow Cytometry: RING1 Antibody (8C12F4) [NBP2-37370] - Flow cytometric analysis of Hela cells using Ring1 mouse mAb (green) and negative control (red).

Mouse Monoclonal
Species Human
Applications WB, ELISA, Flow...MORE

MAB1489
Western blot shows lysates of MCF‑7 human breast cancer cell line untreated (-) or treated (+) with 1 µM Camptothecin (CPT) for 5 hours. PVDF membrane was probed with 1:1000 dilution of Rabbit Anti-Human Phospho-p53 (S46) Monoclonal Antibody (Catalog # MAB1489) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for phospho-p53 (S46) at approximately 53 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.

Rabbit Monoclonal
Species Human
Applications WB

NB100-2379
Western Blot: OCT4 Antibody [NB100-2379] - Detection of OCT4 in mouse brain lysate.Immunocytochemistry/Immunofluorescence: OCT4 Antibody [NB100-2379] - OCT4 staining in NTERA-2 cells detected with a Dylight 488 labeled secondary antibody.Flow Cytometry: OCT4 Antibody [NB100-2379] - Staining of NTERA-2  cells using NB100-2379 at a 1:50 dilution detected using Dylight-488 conjugated goat anti-rabbit secondary antibody.

Rabbit Polyclonal
Species Human, Mouse, Rat...MORE
Applications WB, Flow, ICC/IF

8 Publications
NBP2-29463
Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1 (HJ21)) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).

Mouse Monoclonal
Species Human, Mouse, Rat...MORE
Applications WB, ELISA, Flow...MORE

9 Publications
NB100-317
Western Blot: Telomerase reverse transcriptase Antibody (2C4) [NB100-317] - 1:500 dilution on MJ90 cells.Immunohistochemistry: Telomerase reverse transcriptase Antibody (2C4) [NB100-317] - Pancreatic carcinoma showing strong staining of tumor cells.Flow Cytometry: Telomerase reverse transcriptase Antibody (2C4) [NB100-317] - Staining of NTERA-2 cells using NB100-317at a 1:200 dilution detected using Dylight-488 conjugated goat anti-mouse IgM secondary antibody.

Mouse Monoclonal
Species Human, Mouse
Applications WB, Flow, ICC/IF...MORE

13 Publications
NB120-16518
Western Blot:  CD133 Antibody [NB120-16518] - Predicted band size : 97 kDa recognizes 97 kDa human CD133 in Y79 cells. Band is at ~120 kDa due to protein glycosylation.Immunohistochemisrty:  CD133 Antibody [NB 120-16518] - Staining CD133 in human hepatocarcinoma (HC) tissue by Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections). NB 120-16518 was peroxidase-conjugated to the secondary antibody, followed by AEC staining.Immunofluorescence:  CD133 Antibody [NB 120-16518] - Staining CD133 in Bone Marrow Mononuclear Cells by Immunofluorescence.

Rabbit Polyclonal
Species Human, Mouse, Rat
Applications WB, ELISA, Flow...MORE

3 Publications
NB100-524
Western Blot: NOD2 Antibody (2D9) [NB100-524] - Western Blot Image of anti-NOD2 (2D9) Whole cell protein from THP-1 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 2 ug/ml anti-NOD2 in 1% milk, and detected with an anti-mouse HRP secondary antibody using chemiluminescence.Immunocytochemistry/Immunofluorescence: NOD2 Antibody (2D9) [NB100-524] - A431 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.5% Triton-X100. The cells were incubated with anti-NOD2 (2D9) NB100-524 at a 1:200 dilution overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:500 dilution. Actin was counterstained with Phalloidin 568 (Red) at a 1:200 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.Western Blot: NOD2 Antibody (2D9) [NB100-524] - Detection of NOD2 in 20ug of NOD2 transfected 293T cell lysate using NB 100-524. ECL detection in 10 seconds.

Mouse Monoclonal
Species Human, Mouse
Applications WB, ICC/IF, IHC...MORE

     1 Review

12 Publications

Bioinformatics Tool for BMI-1

Discover related pathways, diseases and genes to BMI-1. Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Bioinformatics Tool
Vizit™, under license from BioVista Inc.

Blogs on BMI-1

There are no specific blogs for BMI-1, but you can read our latest blog posts.