BMI-1 Antibody 0.1 ml

Download Datasheet
See All Related

Ordering Information: NBP1-87321

  • Catalog Number
    NBP1-87321
  • Displayed Format
    Unconjugated
  • Size(s)
  • Availability


    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.
  • Price
    Shipping
  •   

    BMI-1 Antibody Summary

    Species Human
    Tested Applications WB, ICC/IF, IHC, IHC-P
    Clonality
    Polyclonal
    Host
    Rabbit
    Gene
    BMI1
    Purity
    Immunogen affinity purified
    Specificity
    Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
    Guarantee Plus
    All of our products are backed by our 100% guarantee to work for stated and predicted species and applications.
    Innovator's Reward
    Test in a species/application not listed above to receive a full credit towards a future purchase.

    BMI-1 Antibody Details

    Immunogen
    This antibody was developed against Recombinant Protein corresponding to amino acids:RPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG

    Species Reactivity

    Human

    Applications/Dilutions

    Dilutions
    • Western Blot 1:100-1:500
    • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
    • Immunohistochemistry 1:10-1:500
    • Immunohistochemistry-Paraffin 1:50-1:200
    Application Notes
    This antibody is useful for Immunohistochemistry-Paraffin, Western Blot and Immunofluorescence. For IHC-Paraffin HIER pH6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.

    Contact Information

    Product PDFs

    Reviews

    Earn rewards points by submitting your review for BMI-1 Antibody (NBP1-87321). Be the first to review this product and earn double rewards points!

    Publications

    Earn rewards if you have published using BMI-1 Antibody (NBP1-87321).

    Packaging, Storage & Formulations

    Storage
    Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
    Buffer
    PBS, pH 7.2, containing 40% glycerol
    Unit Size
    0.1 ml
    Concentration
    Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
    Preservative
    0.02% Sodium Azide
    Limitations
    This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

    Bioinformatics

    Gene Symbol BMI1

    Alternate Names for BMI-1 Antibody

    • B lymphoma Mo-MLV insertion region 1 homolog
    • B lymphoma Mo-MLV insertion region 1 homolog (mouse)
    • BMI1 polycomb ring finger oncogene
    • FLVI2/BMI1
    • MGC12685
    • murine leukemia viral (bmi-1) oncogene homolog
    • PCGF4
    • polycomb complex protein BMI-1
    • polycomb group protein Bmi1
    • polycomb group ring finger 4
    • RING finger protein 51
    • RNF51Polycomb group RING finger protein 4
    Show More

    Related Products by Gene


    Reviews for BMI-1 Antibody (NBP1-87321) (0)

    There are no reviews for BMI-1 Antibody (NBP1-87321).
    By submitting a review earn points towards our Rewards Program.
    • 250 points for product review
    • 500 additional points for an image with your product review
    • Double points (500) if you are the first to review this product
    • Double points (1000) if you are the first to review this product with an image
    Have you used BMI-1 Antibody (NBP1-87321)? Submit your review and earn rewards points which can be used for merchandise & discounts.
    Points can be redeemed for discounts and gift cards:
    $50/€35/£30/$50CAN Amazon Gift Card1000 Points
    Items ships for Free, please disregard any shipping charges.
    $50/€35/£30/$50CAN Off Purchase (credited after checkout)1000 Points
    Discount is removed from total when the order is processed. The discount will not appear in your shopping cart on check out.

    Publications for BMI-1 Antibody (NBP1-87321) (0)

    There are no publications for BMI-1 Antibody (NBP1-87321).
    By submitting a publication earn 200 points for your submission points towards our Rewards Program.
    Have you published using BMI-1 Antibody (NBP1-87321)? Earn rewards points which can be used for merchandise & discounts.
    Points can be redeemed for discounts and gift cards:
    $50/€35/£30/$50CAN Amazon Gift Card1000 Points
    Items ships for Free, please disregard any shipping charges.
    $50/€35/£30/$50CAN Off Purchase (credited after checkout)1000 Points
    Discount is removed from total when the order is processed. The discount will not appear in your shopping cart on check out.

    Product General Protocols

    Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

    Video Protocols

    WB Video Protocol
    ICC/IF Video Protocol

    Ask a Scientist

    Submit your question on below.
    During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
    For immediate assistance during business hours M- F (excluding major holidays), please contact us.
    CAPTCHA
    This question is for testing whether or not you are a human visitor and to prevent automated spam submissions.

    FAQs for BMI-1 (2)

    1. In the immunohistochemistry paraffin section protocol....the PBS buffer....should it be at certain pH?
      • For IHC application, different labs cites the pH of PBS buffer in the range of 7.1 - 7.6 but most commonly used pH is pH 7.4 (this is what we use in our lab). You may use this PBS (pH 7.4) for making permeablization buffer, antibody diluent buffers and for making wash buffer. For more on the protocol that we use in our lab and for IHC-P troubleshooting suggestions, you may visit: IHC-P Protocol and IHC-P Troubleshooting.
    2. I was wondering what does Format 7C mean as far as anitbodies go?
      • 7C is a fluorophore - it is useful for FLOW. The details of the fluor are (A=425, E=500)