BMI-1 Antibody 0.1 ml

Download Datasheet
See All Related

Ordering Information: NBP1-87321

  • Catalog Number
    NBP1-87321
  • Displayed Format
    Unconjugated
  • Size(s)
    0.1 ml
  • Availability


    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.
  • Price
    Shipping
  •   

    BMI-1 Antibody Summary

    Species Human
    Tested Applications WB, ICC/IF, IHC, IHC-P
    Clonality
    Polyclonal
    Host
    Rabbit
    Gene
    BMI1
    Purity
    Immunogen affinity purified
    Specificity
    Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
    Guarantee Plus
    All of our products are backed by our 100% guarantee to work for stated and predicted species and applications.
    Innovator's Reward
    Test in a species/application not listed above to receive a full credit towards a future purchase.

    BMI-1 Antibody Details

    Immunogen
    This antibody was developed against Recombinant Protein corresponding to amino acids:RPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG

    Species Reactivity

    Human

    Applications/Dilutions

    Dilutions
    • Western Blot 1:100-1:500
    • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
    • Immunohistochemistry 1:10-1:500
    • Immunohistochemistry-Paraffin 1:50-1:200
    Application Notes
    This antibody is useful for Immunohistochemistry-Paraffin, Western Blot and Immunofluorescence. For IHC-Paraffin HIER pH6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.

    Contact Information

    Product PDFs

    Reviews

    Earn rewards points by submitting your review for BMI-1 Antibody (NBP1-87321). Be the first to review this product and earn double rewards points!

    Publications

    Earn rewards if you have published using BMI-1 Antibody (NBP1-87321).

    Packaging, Storage & Formulations

    Storage
    Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
    Buffer
    PBS, pH 7.2, containing 40% glycerol
    Unit Size
    0.1 ml
    Concentration
    Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.
    Preservative
    0.02% Sodium Azide
    Limitations
    This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

    Bioinformatics

    Gene Symbol BMI1

    Alternate Names for BMI-1 Antibody

    • B lymphoma Mo-MLV insertion region 1 homolog
    • B lymphoma Mo-MLV insertion region 1 homolog (mouse)
    • BMI1 polycomb ring finger oncogene
    • FLVI2/BMI1
    • MGC12685
    • murine leukemia viral (bmi-1) oncogene homolog
    • PCGF4
    • polycomb complex protein BMI-1
    • polycomb group protein Bmi1
    • polycomb group ring finger 4
    • RING finger protein 51
    • RNF51Polycomb group RING finger protein 4
    Show More

    Related Products by Gene


    Reviews for BMI-1 Antibody (NBP1-87321) (0)

    There are no reviews for BMI-1 Antibody (NBP1-87321).
    By submitting a review earn points towards our Rewards Program.
    • 250 points for product review
    • 500 additional points for an image with your product review
    • Double points (500) if you are the first to review this product
    • Double points (1000) if you are the first to review this product with an image
    Have you used BMI-1 Antibody (NBP1-87321)? Submit your review and earn rewards points which can be used for merchandise & discounts.
    Points can be redeemed for discounts and gift cards:
    $50/€35/£30/$50CAN Amazon Gift Card1000 Points
    Items ships for Free, please disregard any shipping charges.
    $50/€35/£30/$50CAN Off Purchase (credited after checkout)1000 Points
    Discount is removed from total when the order is processed. The discount will not appear in your shopping cart on check out.

    Publications for BMI-1 Antibody (NBP1-87321) (0)

    There are no publications for BMI-1 Antibody (NBP1-87321).
    By submitting a publication earn 200 points for your submission points towards our Rewards Program.
    Have you published using BMI-1 Antibody (NBP1-87321)? Earn rewards points which can be used for merchandise & discounts.
    Points can be redeemed for discounts and gift cards:
    $50/€35/£30/$50CAN Amazon Gift Card1000 Points
    Items ships for Free, please disregard any shipping charges.
    $50/€35/£30/$50CAN Off Purchase (credited after checkout)1000 Points
    Discount is removed from total when the order is processed. The discount will not appear in your shopping cart on check out.

    Product General Protocols

    Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

    Video Protocols

    WB Video Protocol
    ICC/IF Video Protocol

    Ask a Scientist

    Submit your question on below.
    During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
    For immediate assistance during business hours M- F (excluding major holidays), please contact us.
    CAPTCHA
    This question is for testing whether or not you are a human visitor and to prevent automated spam submissions.

    FAQs for BMI-1 (2)

    1. In the immunohistochemistry paraffin section protocol....the PBS buffer....should it be at certain pH?
      • For IHC application, different labs cites the pH of PBS buffer in the range of 7.1 - 7.6 but most commonly used pH is pH 7.4 (this is what we use in our lab). You may use this PBS (pH 7.4) for making permeablization buffer, antibody diluent buffers and for making wash buffer. For more on the protocol that we use in our lab and for IHC-P troubleshooting suggestions, you may visit: IHC-P Protocol and IHC-P Troubleshooting.
    2. I was wondering what does Format 7C mean as far as anitbodies go?
      • 7C is a fluorophore - it is useful for FLOW. The details of the fluor are (A=425, E=500)

    Customers Who Viewed This Item Also Viewed...

    NB200-106
    Western Blot: p19ARF Antibody [NB200-106] - WB analysis of p19ARF in 1. NIH/3T3 and B. MEF cell lysate.Immunocytochemistry/Immunofluorescence: p19ARF Antibody [NB200-106] - p19ARF antibody was tested in MEF cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).

    Rabbit Polyclonal
    Species Mouse
    Applications WB, ELISA, ICC/IF...MORE

    28 Publications
    NB110-40823
    Western Blot: Bmi1 Antibody [NB110-40823] - Detection of Bmi1 protein in skeletal muscleImmunocytochemistry/Immunofluorescence: Bmi1 Antibody [NB110-40823] - BMI1 antibody was tested in HeLa cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).

    Rabbit Polyclonal
    Species Human, Mouse
    Applications WB, ICC/IF

    NB110-83976
    Western Blot: KMT6/EZH2 Antibody [NB110-83976] - Detection of E2H2 in Jurkat whole cell lysate using NB110-83976.

    Rabbit Polyclonal
    Species Human, Mouse, Primate
    Applications WB

         1 Review

    NB600-302
    Western Blot: c-Myc Antibody (9E10) [NB600-302] - Analysis of c-myc in Jurkat cell lysates using NB600-302.Immunocytochemistry/Immunofluorescence: c-Myc Antibody (9E10) [NB600-302] - HeLa cells stained NB600-302 (Green) detected with DyLight Fluor 488 conjugated anti-mouse IgG secondary antibody.  Nuclei are counterstained with Hoechst 33258 (Blue).

    Mouse Monoclonal
    Species Human, Mouse, Drosophila
    Applications WB, ChIP, ELISA...MORE

         3 Reviews

    19 Publications
    NB110-57434
    Western Blot: PRC1 Antibody (EP1513Y) [NB110-57434] HeLa cells.Immunohistochemistry: PRC1 Antibody (EP1513Y) [NB110-57434] - Immunohistochemical staining of paraffin-embedded human cervical carcinoma using anti-PRC1 (cat. #110-57434).Western Blot: PRC1 Antibody (EP1513Y) [NB110-57434] - HeLa cell lysate using a 1:10,000 dilution.

    Rabbit Monoclonal
    Species Human, Mouse, Rat
    Applications WB, FLOW, ICC/IF...MORE

    21650002

    Rabbit Polyclonal
    Species Human
    Applications WB, ELISA, IHC...MORE

    H00006045-M01
    Western Blot: RNF2 Antibody (6C2) [H00006045-M01] - Western blot analysis of RNF2 over-expressed 293 cell line, cotransfected with RNF2 Validated Chimera RNAi or non-transfected control. Blot probed with H00006045-M01. GAPDH (36.1 kDa) used as loading control.Western Blot: RNF2 Antibody (6C2) [H00006045-M01] - Western Blot analysis of RNF2 expression in Raw 264.7 ( Cat # L024V1 ).Western Blot: RNF2 Antibody (6C2) [H00006045-M01] - Analysis of RNF2 expression in transfected 293T cell line by RNF2 monoclonal antibody (M01), clone 6C2. Lane 1: RNF2 transfected lysate (37.7 KDa). Lane 2: Non-transfected lysate.

    Mouse Monoclonal
    Species Human, Mouse
    Applications WB, ELISA, S-ELISA

    2 Publications
    NBP1-80830
    Western Blot: RING1 Antibody [NBP1-80830] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Negative control (vector only transfected HEK293T lysate)<br/>Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401023)Immunocytochemistry/Immunofluorescence: RING1 Antibody [NBP1-80830] - Staining of human cell line A-431 shows positivity in nucleus but not nucleoli & cytoplasm.Immunohistochemistry-Paraffin: RING1 Antibody [NBP1-80830] - Staining of human nasopharynx shows strong nuclear and moderate cytoplasmic positivity in respiratory epithelial cells.

    Rabbit Polyclonal
    Species Human
    Applications WB, ICC/IF, IHC...MORE

    NB200-103
    Western Blot: p53 Antibody (PAb 240) [NB200-103] - WB analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.

    Mouse Monoclonal
    Species Human, Mouse, Rat...MORE
    Applications WB, ELISA, FLOW...MORE

         2 Reviews

    17 Publications
    NB100-2379
    Western Blot: OCT4 Antibody [NB100-2379] - Detection of OCT4 in mouse brain lysate.Immunocytochemistry/Immunofluorescence: OCT4 Antibody [NB100-2379] - OCT4 staining in NTERA-2 cells detected with a Dylight 488 labeled secondary antibody.Flow Cytometry: OCT4 Antibody [NB100-2379] - Staining of NTERA-2  cells using NB100-2379 at a 1:50 dilution detected using Dylight-488 conjugated goat anti-rabbit secondary antibody.

    Rabbit Polyclonal
    Species Human, Mouse, Rat...MORE
    Applications WB, FLOW, ICC/IF

    4 Publications
    NBP2-29463
    Immunohistochemistry-Paraffin: p21 Antibody (WA-1 (HJ21)) [NBP2-29463] - Formalin-fixed, paraffin-embedded human urinary transitional cell carcinoma stained with p21 antibody at 1:50 using peroxidase-conjugate and DAB chromogen.

    Mouse Monoclonal
    Species Human, Mouse, Rat...MORE
    Applications WB, ELISA, FLOW...MORE

    8 Publications
    NB100-317
    Western Blot: Telomerase reverse transcriptase Antibody (2C4) [NB100-317] - 1:500 dilution on MJ90 cells.Immunocytochemistry/Immunofluorescence: Telomerase reverse transcriptase Antibody (2C4) [NB100-317] - Detection of Tert (Green) in HepG2 cells using NB100-317.  Nuclei (Blue) are counterstained with Hoechst 33258.Immunohistochemistry: Telomerase reverse transcriptase Antibody (2C4) [NB100-317] - Pancreatic carcinoma showing strong staining of tumor cells.

    Mouse Monoclonal
    Species Human, Mouse
    Applications WB, FLOW, ICC/IF...MORE

    11 Publications
    H00008842-G01


    Species Human

    NB100-524
    Western Blot: NOD2 Antibody (2D9) [NB100-524] - Detection of endogenous NOD2 in 50ug of HT29 cell lysate using NB 100-524. ECL detection in 15 minutes.Immunocytochemistry/Immunofluorescence: NOD2 Antibody (2D9) [NB100-524] - analysis of PFA fixed mouse sciatic nerve section using anti-NOD2 antibody. Image from verified customer review. Western Blot: NOD2 Antibody (2D9) [NB100-524] - Detection of NOD2 in 20ug of NOD2 transfected 293T cell lysate using NB 100-524. ECL detection in 10 seconds.

    Mouse Monoclonal
    Species Human, Mouse
    Applications WB, ICC/IF, IHC...MORE

         1 Review

    12 Publications
    NBP2-31143
    Western Blot: CTLA4 Antibody (37B3D8.2F2) [NBP2-31143] - WB analysis of CTLA-4 protein on (A) mouse Kidney lysate (B) human Kidney lysate and on © partial recombinant protein using CTLA-4 monoclonal antibody at a concentration of 2 ug/ml.

    Mouse Monoclonal
    Species Human, Mouse
    Applications WB