Apolipoprotein A I Antibody (H00000335-B01P)
Apolipoprotein A I Antibody
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-MGC117399 antibody, |
|
|
Apolipoprotein A I Antibody Summary: | | Gene: | APOA1 |
|---|
| Purity: | Protein A purified |
|---|
| Host: | Mouse |
|---|
| | Specificity: | APOA1 - apolipoprotein A-I, |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional Apolipoprotein A I Products Apolipoprotein A I Antibody Details: | Immunogen: | APOA1 (NP_000030.1, 1 a.a. ~ 267 a.a) full-length human protein. |
|---|
| Epitope: | MKAAVLTLAVLFLTGSQARHFWQQDEPPQS PWDRVKDLATVYVDVLKDSGRDYVSQFEGS ALGKQLNLKLLDNWDSVTSTFSKLREQLGP VTQEFWDNLEKETEGLRQEMSKDLEEVKAK VQPYLDDFQKKWQEEMELYRQKVEPLRAEL QEGARQKLHELQEKLSPLGEEMRDRARAHV DALRTHLAPYSDELRQRLAARLEALKENGG ARLAEYHAKATEHLSTLSEKAKPALEDLRQ GLLPVLESFKVSFLS |
|---|
| Uses: | Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
|---|
| Dilutions: | Western Blot 1:500,
ELISA |
|---|
| Unit Size: | 0.05 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | In 1x PBS, pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: This gene encodes apolipoprotein A-I, which is the major protein component of high density lipoprotein (HDL) in plasma. The protein promotes cholesterol efflux from tissues to the liver for excretion, and it is a cofactor for lecithin cholesterolacyltransferase (LCAT) which is responsible for the formation of most plasma cholesteryl esters. This gene is closely linked with two other apolipoprotein genes on chromosome 11. Defects in this gene are associated with HDL deficiencies, including Tangier disease, and with systemic non-neuropathic amyloidosis. [provided by RefSeq]
|
Images (2) Reviews (0) Related Products (44) Exploring Apolipoprotein A I
|
Jump to: Images, Ask a Question
|
Working with Apolipoprotein A I
Apolipoprotein A I Antibody Images (2) Western Blot analysis of APOA1 expression in transfected 293T cell line by APOA1 MaxPab polyclonal antibody.
Lane 1: APOA1 transfected lysate(29.37 KDa).
Lane 2: Non-transfected lysate.
|  APOA1 MaxPab polyclonal antibody. Western Blot analysis of APOA1 expression in human colon. |
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about Apolipoprotein A I? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Antibody Pairs, Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsAntibody Pairs (3)Lysates (2)Peptides and ProteinsPrimary Antibodies (36)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Apolipoprotein A I Antibody (EP1368Y) | NB110-55465 | Hu, Mu(-), Rt(-) | ICC, IHC-P, IP, WB | (3) | (3) | | | | Apolipoprotein A I Antibody | NB400-147 | Hu | ELISA, IHC, IHC-P, WB | (2) | (1) | | | | Apolipoprotein A I Antibody | NB600-1538 | Bv(-), Ca, Ch(-), Eq(-), Fe(-), Gp(-), Gt(-), Hu, Mu(-), Po(-), Rb, Rt(-) | ELISA, IHC-Fr, RI | | | | | | Apolipoprotein A I Antibody | NB600-609 | Mu | ELISA, IHC-P, IP, WB | | (2) | | | | Apolipoprotein A I Antibody | NBP1-50239 | Hu | ELISA, IHC-P, IP, WB | (1) | | | | | ... and 31 more. See All » |
RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
Jump to: Novus Explorer, Research Areas
| Apolipoprotein A I in Context
Research Areas related to Apolipoprotein A I (4): |
|
Novus Explorer for Apolipoprotein A I gene
|
|
