Recombinant Human Apolipoprotein E/ApoE Protein Summary
| Description |
Partial recombinant protein corresponding to 299 amino acids of Human APOE Source: Escherichia coli Amino Acid Sequence:MKVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKRLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNH |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein |
| Gene |
APOE |
| Purity |
>90%, by SDS-PAGE |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
Lyophilized from 20mM sodium phosphate |
| Preservative |
No Preservative |
| Concentration |
LYOPH |
| Purity |
>90%, by SDS-PAGE |
| Reconstitution Instructions |
Reconstitute with distilled water. |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human Apolipoprotein E/ApoE Protein
Background
Apolipoprotein E (APOE) is an apolipoprotein located in chylomicrons and intermediate-density lipoproteins that is necessary for the normal catabolism of triglyceride-rich lipoprotein constituents in the liver. APOE has recently been shown to be involseveral biological processes other than lipoprotein transport, including cognition and immunoregulation.
Lipoproteins are responsible for carrying cholesterol and other fats through the bloodstream as little packages and are essential for the normal breakdown of these molecules. In particular, apolipoprotein E is a major component of specific lipoproteins called very low-density lipoproteins (VLDL). A major function of VLDLs is to remove excess cholesterol from the blood and carry it to the liver for processing. Maintaining normal levels of cholesterol is essential for the prevention of cardiovascular diseases, including heart attacks and strokes.
The three Apo E isoforms are strongly associated with cardiovascular disease and Alzheimer's disease, so ApoE antibodies have become useful tools for research in both of these areas.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Mu
Applications: Block, CyTOF-ready, Flow, IHC, WB
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu
Applications: ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Publications for Apolipoprotein E/ApoE Recombinant Protein (P4123) (0)
There are no publications for Apolipoprotein E/ApoE Recombinant Protein (P4123).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Apolipoprotein E/ApoE Recombinant Protein (P4123) (0)
There are no reviews for Apolipoprotein E/ApoE Recombinant Protein (P4123).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Apolipoprotein E/ApoE Recombinant Protein (P4123) (0)
Additional Apolipoprotein E/ApoE Products
Research Areas for Apolipoprotein E/ApoE Recombinant Protein (P4123)
Find related products by research area.
|
Blogs on Apolipoprotein E/ApoE