Apg3 Antibody (1G3) Summary:

Species:	Hu
Applications:	ELISA, WB
Clonality:	Monoclonal

Gene:	ATG3
Purity:	IgG purified
Host:	Mouse

Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur.

View Additional Apg3 Products

Lysates	Peptides and Proteins
Primary Antibodies	RNAi

» View all Apg3 Related Products

Apg3 Antibody (1G3) Details:

Clone:	1G3
Isotype:	IgG2b Kappa
Immunogen:	ATG3 (NP_071933, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Epitope:	MQNVINTVKGKALEVAEYLTPVLKESKFKE TGVITPEEFVAAGDHLVHHCPTWQWATGEE LKVKAYLPTGKQFLVTKNVPCYKRCKQMEY SDELEAIIEE*

Species Reactivity:

This product is reactive against Human.

Applications:

Uses:	This antibody is useful for ELISA, Western Blot
Dilutions:	ELISA, Western Blot
Unit Size:	0.1 mg
Concentration:	Please see the vial label for concentration.

Notes:

This product is produced by and distributed for Abnova, a company based in Taiwan.

Packaging:

Storage:	Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles.
Buffer:	In 1x PBS, pH 7.2
Preservative:	No Preservative
Limitations:	This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months.

Gene Symbol: ATG3

Swiss Prot	NP_071933 (Human)

Background:

Autophagy is a process of bulk degradation of cytoplasmic components by the lysosome or vacuole. Human ATG3 displays the same enzymatic characteristics in vitro as yeast Apg3, a protein-conjugating enzyme essential for autophagy (Tanida et al., 2002 [PubMed 11825910]).[supplied by OMIM]

Reviews (0)

Be the first to review this product for a reward!

Working with Apg3

Apg3 Antibody (1G3) Images (0)

Reviews (0) Have you used this product? Review this product to earn Novus Rewards.

Protocols

All General Protocols

Ask a Scientist

Can't find an answer to your question about Apg3? Ask us by using live chat or by submitting your questions below:

Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies

Related Products

Lysates (1)

Name	Catalog#	Reactivity	Applications	Images	Publications	Reviews
Apg3 Lysate	NBL1-07796		WB	(1)

Peptides and Proteins

Name	Catalog#	Reactivity	Applications	Images
Apg3 Recombinant Protein	H00064422-P01	Hu	ELISA, WB	(1)
Apg3 Partial Recombinant Protein	H00064422-Q01	Hu	ELISA, WB	(1)
Apg3 Peptide	NBP1-77168PEP	Hu	B/N

Primary Antibodies (12)

Name	Catalog#	Reactivity	Applications	Images	Publications
Apg3 Antibody	R-159-100	Hu, Rt	IF, IHC-P, WB	(4)	(1)
Apg3 Antibody (EPR4801)	NBP1-95645	Hu, Mu, Rt	ICC, IF, IHC-P, WB	(3)
Apg3 Antibody (EPR4802)	NBP1-95706	Hu, Mu, Rt	ELISA, FACS, IP, WB	(2)
Apg3 Antibody	NBP1-77168	Hu, Mu, Rt	ELISA, IHC-P, WB	(2)
Apg3 Antibody	NB110-74780	Hu, Mu, Rt	IHC-Fr, IHC-P, WB		(3)
... and 7 more. See All »

RNAi (1)

Name	Catalog#	Reactivity	Applications	Images	Publications	Reviews
Apg3 RNAi	H00064422-R01	Hu		(1)	(4)

Secondary Antibodies

Name	Catalog#	Reactivity	Applications	Publications
Mouse IgG Antibody [Biotin]	NB720-B	Mu	ELISA, IHC-P, WB
Mouse IgG Antibody [HRP]	NB720-H	Mu	ELISA, ICC, IHC-P, WB
Mouse IgG Antibody [Alkaline Phosphatase]	NB720-AP	Mu	ELISA, ICC, IHC-P, WB
Mouse IgG Antibody [FITC]	NB720-F	Mu	ICC, IHC-P	(2)
Mouse IgG Antibody	NB120-7056	Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-)	ELISA, IHC-P, IP, WB
See All »

Jump to: Novus Explorer, Research Areas

Apg3 in Context

Research Areas related to Apg3 (2):

Novus Explorer for Apg3 gene

Try our bioinformatic tool that shows the relationships between ATG3 and other genes, diseases, pathways and post-translational modifications.

Apg3 Antibody (H00064422-M04)

Apg3 Antibody (1G3)