Apg3 Antibody (H00064422-M06)
Apg3 Antibody (1F7)
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-APG3 antibody, anti-PC3-96 antibody, anti-MGC15201 antibody, anti-FLJ22125 antibody, anti-DKFZp564M1178 antibody, anti-APG3L antibody, |
|
|
Apg3 Antibody (1F7) Summary: | | Gene: | ATG3 |
|---|
| Purity: | IgG purified |
|---|
| Host: | Mouse |
|---|
| | Specificity: | ATG3 autophagy related 3 homolog (S. cerevisiae) |
|---|
| |
| | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional Apg3 Products Apg3 Antibody (1F7) Details: | Clone: | 1F7 |
|---|
| Isotype: | IgG2b Kappa |
|---|
| Immunogen: | ATG3 (NP_071933, 1 a.a. ~ 101 a.a) partial recombinant protein with GST tag. |
|---|
| Epitope: | MQNVINTVKGKALEVAEYLTPVLKESKFKE TGVITPEEFVAAGDHLVHHCPTWQWATGEE LKVKAYLPTGKQFLVTKNVPCYKRCKQMEY SDELEAIIEE* |
|---|
Human. Other species not tested. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
|---|
| Dilutions: | ELISA,
Western Blot 1:500 |
|---|
| Unit Size: | 0.1 mg |
|---|
| Concentration: | Please see the vial label for concentration. |
|---|
|
Notes: This product is produced by and distributed for Abnova, a company based in Taiwan. Packaging: | Storage: | Aliquot and store at -20 °C or -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | 1X PBS pH 7.2 |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: Autophagy is a process of bulk degradation of cytoplasmic components by the lysosome or vacuole. Human ATG3 displays the same enzymatic characteristics in vitro as yeast Apg3, a protein-conjugating enzyme essential for autophagy (Tanida et al., 2002 [PubMed 11825910]).[supplied by OMIM]
|
Images (2) Reviews (0) Related Products (17) Exploring Apg3
|
Jump to: Images, Ask a Question
|
Working with Apg3
Apg3 Antibody (1F7) Images (2) ATG3 monoclonal antibody (M06), clone 1F7 Western Blot analysis of ATG3 expression in Jurkat ( Cat # L017V1 ). |  Detection limit for recombinant GST tagged ATG3 is approximately 1ng/ml as a capture antibody. |
|
|
|
|
|
|
|
Ask a Scientist
Can't find an answer to your question about Apg3? Ask us by using live
chat or by submitting your questions below:
|
Jump to: Lysates, Peptides and Proteins, Primary Antibodies, RNAi, Secondary Antibodies
|
Related ProductsLysates (1)Peptides and ProteinsPrimary Antibodies (12)| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Apg3 Antibody | R-159-100 | Hu, Rt | IF, IHC-P, WB | (4) | (1) | | | | Apg3 Antibody (EPR4801) | NBP1-95645 | Hu, Mu, Rt | ICC, IF, IHC-P, WB | (3) | | | | | Apg3 Antibody (EPR4802) | NBP1-95706 | Hu, Mu, Rt | ELISA, FACS, IP, WB | (2) | | | | | Apg3 Antibody | NBP1-77168 | Hu, Mu, Rt | ELISA, IHC-P, WB | (2) | | | | | Apg3 Antibody | NB110-74780 | Hu, Mu, Rt | IHC-Fr, IHC-P, WB | | (3) | | | | ... and 7 more. See All » |
RNAi (1)Secondary Antibodies| Name | Catalog# | Reactivity | Applications | Images | Publications | Reviews | |
|---|
| Mouse IgG Antibody [Biotin] | NB720-B | Mu | ELISA, IHC-P, WB | | | | | | Mouse IgG Antibody [HRP] | NB720-H | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [Alkaline Phosphatase] | NB720-AP | Mu | ELISA, ICC, IHC-P, WB | | | | | | Mouse IgG Antibody [FITC] | NB720-F | Mu | ICC, IHC-P | | (2) | | | | Mouse IgG Antibody | NB120-7056 | Bv(-), Ch(-), Eq(-), Gp(-), Gt(-), Ha(-), Hu(-), Mu, Rb(-), Rt(-), Sh(-) | ELISA, IHC-P, IP, WB | | | | | | See All » |
|
|
