Adiponectin Protein (NBC1-18477)
Adiponectin Protein
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-adipocyte complement-related protein antibody, anti-GBP28 antibody, anti-ACRP30 antibody, anti-ACDC antibody, |
|
|
Adiponectin Protein Summary: | | Gene: | ADIPOQ |
|---|
| Purity: | Protein |
|---|
| | | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional Adiponectin Products Adiponectin Protein Details: | Immunogen: | MGSSHHHHHHSSGLVPRGSHMEDDVTTTEE LAPALVPPPKGTCAGWMAGIPGHPGHNGTP GRDGRDGTPGEKGEKGDAGLLGPKGETGDV GMTGAEGPRGFPGTPGRKGEPGEAAYVYRS AFSVGLETRVTVPNVPIRFTKIFYNQQNHY DGSTGKFYCNIPGLYYFSYHITVYMKDVKV SLFKKDKAVLFTYDQYQEKNVDQASGSVLL HLEVGDQVWLQVYGDGDHNGLYADNVNDST FTGFLLYHDTN |
|---|
| Uses: | This product is useful for ELISA and SDS-Page. The purity of this protein is > 90% by SDS - PAGE. This recombinant protein was expressed in E.Coli bacteria. The endotoxin levels of this protein have not yet been determined. |
|---|
| Dilutions: | ELISA, SDS-Page |
|---|
| Unit Size: | 0.1 mg |
|---|
| Concentration: | 1.0 mg/ml |
|---|
|
Packaging: | Storage: | Store at -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | 20mM Tris pH 8.0, 1mM DTT, 10% Glycerol |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: Adiponectin is an adipocyte specific secreted protein that circulates in the plasma. It is induced during adipocyte differentiation and its secretion is stimulated by insulin. Mouse adiponectin shares about 83% amino acid identity with that human. Adiponectin plays a role in various physiological processes such as energy homeostasis and obesity. Adiponectin is reduced in obese humans, and decreased level is associated with insulin resistance and hyperinsulinemia. Recombinant mouse adiponectin, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
|
Images (1) Reviews (0) Related Products (84) Exploring Adiponectin Working with Adiponectin
|
Jump to: Publications, Images, Ask a Question
|
Working with Adiponectin
Adiponectin Protein Images (1) SDS-Page: Adiponectin Protein [NBC1-18477] - Adiponectin, 27.2 kDa (251 aa) , confirmed by MALDI-TOF with a purity of 90% by SDS - PAGE |
|
|
|
Publications (1)Adiponectin Protein Background References:- Yokota. T. et al. (2000) Blood. 96:1723Yamauchi T. et al (2002) Nature Medicine.8(11):1288-1295Lu M. et al (2007) Mol Endocrinol. 59(2):207-16
|
|
|
|
Ask a Scientist
Can't find an answer to your question about Adiponectin? Ask us by using live
chat or by submitting your questions below:
|
|
