Adiponectin Protein (NBC1-18461)
Adiponectin Protein
|
This product is fully covered under the Novus guarantee+ Policy.
Click
here for details.
|
|
Distributor Data...
|
|
anti-ADIPOQ antibody, anti-GBP-28 antibody, anti-APM-1 antibody, anti-ACRP30 antibody, |
|
|
Adiponectin Protein Summary: | | Gene: | ADIPOQ |
|---|
| Purity: | Protein |
|---|
| | | Note: Not all species have been tested for usefulness with this product. Only those species listed have been tested. We cannot make any guarantees about additional reactivities which may or may not occur. |
View Additional Adiponectin Products Adiponectin Protein Details: | Immunogen: | MGHDQETTTQGPGVLLPLPKGACTGWMAGI PGHPGHNGAPGRDGRDGTPGEKGEKGDPGL IGPKGDIGETGVPGAEGPRGFPGIQGRKGE PGEGAYVYRSAFSVGLETYVTIPNMPIRFT KIFYNQQNHYDGSTGKFHCNIPGLYYFAYH ITVYMKDVKVSLFKKDKAMLFTYDQYQENN VDQASGSVLLHLEVGDQVWLQVYGEGERNG LYADNDNDSTFTGFLLYHDTN |
|---|
| Uses: | This product is useful as positive control for ELISA and SDS-Page. Purity is > 90 % by SDS-Page. |
|---|
| Dilutions: | ELISA, SDS-Page |
|---|
| Unit Size: | 0.1 mg |
|---|
| Concentration: | 1.0 mg/ml |
|---|
|
Packaging: | Storage: | Store at -80 °C. Avoid freeze-thaw cycles. |
|---|
| Buffer: | Liquid. In PBS, pH 7.4 containing 1 mM DTT |
|---|
| Preservative: | No Preservative |
|---|
| Limitations: | This product is for research use only and is not approved for use in humans or in clinical diagnosis. Products are guaranteed for 6 months from date of receipt, except for peptides and proteins which are guaranteed for 3 months. |
|---|
Background: Human Adiponectin, also referred to as AdipoQ, Acrp30, apm-1 or GBP28, is a secreted protein expressed exclusively in differentiated adipocyte(adipokine). Adiponectin contains a modular structure comprising an N-terminal collagenous domain followed by a C-terminal globular domain. Adiponectin plays a role in various physiological processes such as energy homeostasis and obesity. Plasma levels of adiponectin are reduced in obese humans, and decreased levels are associated with insulin resistance and hyperinsulinemia.
|
Images (1) Reviews (0) Related Products (84) Exploring Adiponectin Working with Adiponectin
|
Jump to: Publications, Images, Ask a Question
|
Working with Adiponectin
Adiponectin Protein Images (1) SDS-Page: Adiponectin Protein [NBC1-18461] - Adiponectin, 25.1 kDa (231 aa) with a purity of 90% by SDS - PAGE |
|
|
|
Publications (4)Adiponectin Protein Background References:- Yamauchi T et al., (2002) Nat Med. 8:1288-95
- Berg AH., et al. (2002) Trends Endocrinol Metab. 13: 84-89.
more... - Berg AH., et al. (2001) Nat Med; 7:947-53
- Maeda K., et al. (1996) Biochem Biophys Res Commun. 221:286-9.
|
|
|
|
Ask a Scientist
Can't find an answer to your question about Adiponectin? Ask us by using live
chat or by submitting your questions below:
|
|
